entry lat lon depth NCBI_FASTA_link protein_probability num_unique_peptide indep_spectra_tot peptide_seq consensus_annotation KEGG_category 79a 45.934 -130.0138 1450 gi|269469034|gb|EEZ80598.1| 1 2 99 EALSEIGVSGITATEVK Gamma sulfur oxidizers_nitrogen regulatory protein PII Environmental Information Processing; Signal Transduction; Two-component system 79a 45.934 -130.0138 1450 gi|269469034|gb|EEZ80598.1| 1 2 99 GAEYTVDFLPK Gamma sulfur oxidizers_nitrogen regulatory protein PII Environmental Information Processing; Signal Transduction; Two-component system 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 LMDEYAGGVTVQYMTNDK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 IMVTHLLMDDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 NHAFISEVAAGR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 WQIMIHGESYKPIVAEAAK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 LMDEYAGGVTVQYM[147]TNDK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 IM[147]VTHLLMDDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 VAAEDIHQLLR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 LM[147]DEYAGGVTVQYMTNDK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 IM[147]VTHLLM[147]DDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 FEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 MDLMGMVR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 HVDSAVHKFEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 IMVTHLLM[147]DDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 60a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 14 71 RADLPEGDIGK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism; Energy Metabolism; Sulfur metabolism 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 DIIAILGMDELSEEDKQSVSR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 MPSAVGYQPTLASEMGALQER Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 NIAIEHSGYSVFAGVGER Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 QVAELGIYPAVDPLDSTSR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 VALTGLTM[147]AEYFR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 VSLVYGQMNEPPGNR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 YTLAGTEVSALLGR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 DVLLFIDNIYR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 M[147]PSAVGYQPTLASEMGALQER Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 MPSAVGYQPTLASEM[147]GALQER Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 TVNMMELIR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 DEGRDVLLFIDNIYR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 VSLVYGQM[147]NEPPGNR Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 69a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 14 67 DIIAILGMDELSEEDK Gamma sulfur oxidizers_F0F1-type ATP synthase; beta subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 ADVPLAEMFGYANDLR Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 AIYWNEEDQGATYETK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 GVQEQMENGVLAGFPLVDIK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 IATDPFVGTLTFFR Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 IEPQEPGAGYEFVDEIK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 IGEVHDGGATMDWMEQEQER Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 MEFPEPVIALAVEPK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 VTVYDGSYHDVDSNEMAFK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 GVQEQM[147]ENGVLAGFPLVDIK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 AGDIAAAIGLK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 EAITTLVEHQHK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 76a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 12 58 GLVGAMEDLPNGK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing; Translation; Translation factors 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 AFESFPGDADSLYPGWR Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 DLDAMVYEIDEAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 DLDAM[147]VYEIDEAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 DRNDGGYIAGTIIKPK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 LPGFFENLGHGNVINTSGGGSYGHIDSPAAGAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 NDGGYIAGTIIKPK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 GYTAFVLAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 DSADGPVYHQEWFGMKPTTPIISGGMNALR Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 9 54 NIAYMIER Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 LLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 MQVELLSPIAMEDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 MQVELLSPIAM[147]EDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 FEAEVYILSK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 M[147]QVELLSPIAMEDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 M[147]QVELLSPIAM[147]EDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 TTDVTGACQLPDGVEMVMPGDNVK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 9 46 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 61a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 6 39 AAVTGDTVGDPYK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism; Energy Metabolism; Oxidative phosphorylation 61a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 6 39 AAVTGDTVGDPYKDTAGPAINPLIK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism; Energy Metabolism; Oxidative phosphorylation 61a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 6 39 EMPGIMDYTQKPDYSK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism; Energy Metabolism; Oxidative phosphorylation 61a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 6 39 NITDPLDAVGNTTK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism; Energy Metabolism; Oxidative phosphorylation 61a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 6 39 VSDGGSIMGALYK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism; Energy Metabolism; Oxidative phosphorylation 61a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 6 39 NGMDAAFQVAFK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism; Energy Metabolism; Oxidative phosphorylation 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 DSVEEKAAMADYNK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 DSVEEKAAM[147]ADYNK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 LGQEVDVVVLDVQESK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 VGALLMGTVVSINR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 VTGTVSNLTDYGAFVR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 VGALLM[147]GTVVSINR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 LWQSLETAM[147]NAK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 GQELEVVILNIDAEKER Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 AFLPGSLVDVRPVK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 QLTASPWDNISDR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 DFSYLTGQEIEAIVIK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 EALLETLEEGK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 31 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 13 30 GGLTVDIGVVK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 DIALSYASAIGGGR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 GGGIPDLIAVQQDVSGTAK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 YSISNTAEYGDVTR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 LIVDLMYEGGIANMR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 IYTDNIEPNLK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 EFVANVGDLPAR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 ILGEIQDGSFAK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 72a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 8 27 TGILETSFR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins; Pantothenate and CoA biosynthesis 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 AGELGVDIYNLTK Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 LGPEEITADIPNVSESALAK Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 QISSVAASLIPFLEHDDANR Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 STGPYSLVTQQPLSGK Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 FGEMEVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 EFFGSSQLSQFMDQVNPLSGVTHK Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 FGEM[147]EVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 SETGEHVLTNDDIISVLK Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 LDEVGVVYVGAR Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 SINAPLEYLLDK Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 EGLNLAETDELTPQDLINSKPVSAAVR Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 81a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 12 26 ISALGPGGLTR Gamma sulfur oxidizers_DNA-directed RNA polymerase; beta subunit Genetic Information Processing; Transcription; RNA polymerase 90a 45.934 -130.0138 1450 gi|344263298|gb|EGW23569.1| 1 2 25 FAGLLFFFDEAGNR Methylotrophs_methane monooxygenase/ammonia monooxygenase; subunit B Metabolism; Energy Metabolism; methane metabolism or nitrogen metabolism 90a 45.934 -130.0138 1450 gi|344263298|gb|EGW23569.1| 1 2 25 LADLIYDPDSR Methylotrophs_methane monooxygenase/ammonia monooxygenase; subunit B Metabolism; Energy Metabolism; methane metabolism or nitrogen metabolism 49a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 3 24 DHGFMPIVVDVVSK Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism; Energy Metabolism; Oxidative phosphorylation 49a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 3 24 QDANPGFINDAWAKIDEIGTYR Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism; Energy Metabolism; Oxidative phosphorylation 49a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 3 24 FLITSNDVIHNWWVPDFGVK Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism; Energy Metabolism; Oxidative phosphorylation 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 INAEDPNNFMPSPGK Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 VEESGFIFIGPR Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 VQVEHPVTEMITGIDIVR Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 MQNALDEMVIDGIK Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 VVEEAPAPGITPELR Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 M[147]QNALDEMVIDGIK Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 ITQYHVAGGLGVR Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 67a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 8 24 INAEDPNNFM[147]PSPGK Gamma sulfur oxidizers_biotin carboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or propanoate metabolism or Lipid Metabolism; Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides; Tetracycline biosynthesis 75a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 4 24 IVYDALDTIEAK Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing; Translation; Ribosome 75a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 4 24 VGGSTYQVPIEVR Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing; Translation; Ribosome 75a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 4 24 LAGEVLDAVQNR Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing; Translation; Ribosome 75a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 4 24 FGDLVLAK Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing; Translation; Ribosome 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 GNFMGTWDQVLVNSLR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 LMWDVAADYLR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 MGGMDYTIDPAAGLGER Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 VSGWAQVGSIGNGR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 IAVIGQAFPR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 YIGVMDLNIVDHK Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 YDGNGLFDEDEALPFKPYVIK Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77a 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 8 24 TYDAILTEK Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 82a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 5 23 AEAAGADVVGMEDLMK Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing; Translation; Ribosome 82a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 5 23 AEAAGADVVGM[147]EDLM[147]K Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing; Translation; Ribosome 82a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 5 23 SMQDGDLNYDVVIASPDAMGVVGR Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing; Translation; Ribosome 82a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 5 23 VGTVTPDVATAVNNAK Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing; Translation; Ribosome 82a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 5 23 VAVFTQGDNVAK Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing; Translation; Ribosome 29 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 21 DDAWGGSDFTFGDVTLR Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 29 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 21 GSNPLTLTLER Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 29 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 21 SQSYEIFIPSIR Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 29 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 21 FAEPARDDAWGGSDFTFGDVTLR Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 50a 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 7 21 VAGAVGFNVR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 50a 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 7 21 VWYAPWSSGSAYGLLIEAGAK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 50a 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 7 21 TYTQNGYGDEYESK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 50a 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 7 21 TTIVGAGGASNIFKPR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 50a 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 7 21 FEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 50a 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 7 21 MDLMGMVR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 50a 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 7 21 HVDSAVHKFEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 20 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 5 19 EFGFTVDNVVATAK Gamma sulfur oxidizers_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 20 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 5 19 TAGHPEYGYAEGIETTTGPLGQGITNAVGMAIAER Gamma sulfur oxidizers_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 20 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 5 19 GNAPTGLVFSR Gamma sulfur oxidizers_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 20 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 5 19 ANSGHPGAPMGMADIAEVLWNDHMK Gamma sulfur oxidizers_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 20 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 5 19 TAGHPEYGYAEGIETTTGPLGQGITNAVGM[147]AIAER Gamma sulfur oxidizers_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 22 45.934 -130.0138 1450 gi|269468229|gb|EEZ79919.1| 1 3 19 DANVVAPFDGVIVVK Gamma sulfur oxidizers_hypothetical protein Sup05_1072 Unassigned 22 45.934 -130.0138 1450 gi|269468229|gb|EEZ79919.1| 1 3 19 LKDANVVAPFDGVIVVK Gamma sulfur oxidizers_hypothetical protein Sup05_1072 Unassigned 22 45.934 -130.0138 1450 gi|269468229|gb|EEZ79919.1| 1 3 19 SSLPSVFVINPK Gamma sulfur oxidizers_hypothetical protein Sup05_1072 Unassigned 100 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 0.9998 3 19 DSANGDTSVLVVDAR Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 100 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 0.9998 3 19 TIYNFCNGAWCGQSPASIR Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 100 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 0.9998 3 19 KGTIPHAINVPFTK Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 59a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 4 19 AAIGTTGNGIGPAYEDK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism; Nucleotide metabolism; purine metabolism or Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism 59a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 4 19 VGGGPFPTELIYDVSTDEGDEIGK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism; Nucleotide metabolism; purine metabolism or Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism 59a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 4 19 NVVIIGTQWGDEGK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism; Nucleotide metabolism; purine metabolism or Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism 59a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 4 19 FQGGHNAGHTLVIDGKK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism; Nucleotide metabolism; purine metabolism or Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism 86a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 7 19 TTEDAHPGVVMVKAQGK Gamma sulfur oxidizers_ATP sulfurylase Metabolism; Energy Metabolism; Sulfur metabolism or Nucleotide Metabolism; Purine metabolism 86a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 7 19 VLQAYYATIK Gamma sulfur oxidizers_ATP sulfurylase Metabolism; Energy Metabolism; Sulfur metabolism or Nucleotide Metabolism; Purine metabolism 86a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 7 19 DHAGVDDYYGPFDAHNIFDEIADDALVTQPLK Gamma sulfur oxidizers_ATP sulfurylase Metabolism; Energy Metabolism; Sulfur metabolism or Nucleotide Metabolism; Purine metabolism 86a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 7 19 MLSDGEDLPEEFSRPEVAK Gamma sulfur oxidizers_ATP sulfurylase Metabolism; Energy Metabolism; Sulfur metabolism or Nucleotide Metabolism; Purine metabolism 86a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 7 19 LVPPHGSDTINALALSGDALSAELSR Gamma sulfur oxidizers_ATP sulfurylase Metabolism; Energy Metabolism; Sulfur metabolism or Nucleotide Metabolism; Purine metabolism 86a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 7 19 EALLHALFR Gamma sulfur oxidizers_ATP sulfurylase Metabolism; Energy Metabolism; Sulfur metabolism or Nucleotide Metabolism; Purine metabolism 86a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 7 19 VLSDGGFPAK Gamma sulfur oxidizers_ATP sulfurylase Metabolism; Energy Metabolism; Sulfur metabolism or Nucleotide Metabolism; Purine metabolism 46a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 4 18 SVAAGMNPMDLK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 46a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 4 18 AAVEEGVVPGGGVALVR Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 46a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 4 18 NLMLDGVNMLANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 46a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 4 18 NLMLDGVNM[147]LANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 46a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 4 18 SVAAGMNPMDLK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 46a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 4 18 AAVEEGVVPGGGVALVR Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 46a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 4 18 NLMLDGVNMLANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 46a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 4 18 NLMLDGVNM[147]LANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 93a 45.934 -130.0138 1450 gi|357406677|ref|YP_004918601.1 0.9996 2 18 ALEGDTSDIGVPSILK Methylotrophs_tufB gene product Unassigned 93a 45.934 -130.0138 1450 gi|357406677|ref|YP_004918601.1| 0.9996 2 18 LLDQGQAGDNVGVLLR Methylotrophs_tufB gene product Unassigned 93a 45.934 -130.0138 1450 gi|357406689|ref|YP_004918613.1| 0.9996 2 18 ALEGDTSDIGVPSILK Methylotrophs_tufB gene product Unassigned 93a 45.934 -130.0138 1450 gi|357406689|ref|YP_004918613.1| 0.9996 2 18 LLDQGQAGDNVGVLLR Methylotrophs_tufB gene product Unassigned 32 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 17 DQFEEILDGIPPYEEAVEK Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 32 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 17 LAHPYYDDAAGTVVTLEGTIR Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 32 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 17 DMEFFHQAMSNGIEISADR Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 32 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 17 WGGIGTLHR Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 32 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 17 ISSWISDQAAGEK Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 54a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 17 MNLIDQIENEQLR Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing; Translation; Ribosome 54a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 17 M[147]NLIDQIENEQLR Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing; Translation; Ribosome 54a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 17 LQAFEGVVIAK Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing; Translation; Ribosome 54a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 17 GIGSAFTVR Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing; Translation; Ribosome 87a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 17 ATVEGLTSMTSPQSVAAK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing; Translation; Ribosome 87a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 17 ATVEGLTSM[147]TSPQSVAAK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing; Translation; Ribosome 87a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 17 SVLEAVGVHNILAK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing; Translation; Ribosome 87a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 17 IFGFSALVVVGDGNGK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing; Translation; Ribosome 44a 45.934 -130.0138 1450 gi|118602544|ref|YP_903759.1| 1 3 16 LINEAQTYANDILPK Gamma sulfur oxidizers_HflK protein Unassigned 44a 45.934 -130.0138 1450 gi|118602544|ref|YP_903759.1| 1 3 16 INDVQAYLFNVANPDTTLR Gamma sulfur oxidizers_HflK protein Unassigned 44a 45.934 -130.0138 1450 gi|118602544|ref|YP_903759.1| 1 3 16 ANSMMYLPIDK Gamma sulfur oxidizers_HflK protein Unassigned 45a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 4 16 EIDDVPIINLTLWSK Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 45a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 4 16 ITIGTAIDAVR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 45a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 4 16 ATGEQAVTIAIAK Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 45a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 4 16 LIPDNVEVSVTR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 66a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 4 16 DIHGISEETTTGVHR Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism; Amino Acid Metabolism; Cysteine and methionine metabolism 66a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 4 16 VPAINVNDSVTK Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism; Amino Acid Metabolism; Cysteine and methionine metabolism 66a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 4 16 ALVIGYGDVGK Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism; Amino Acid Metabolism; Cysteine and methionine metabolism 66a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 4 16 VADM[147]SLADYGR Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism; Amino Acid Metabolism; Cysteine and methionine metabolism 80a 45.934 -130.0138 1450 gi|269469114|gb|EEZ80662.1| 1 3 16 IAENGAVVPMTVDASK Gamma sulfur oxidizers_sulfur oxidation protein SoxY Unassigned 80a 45.934 -130.0138 1450 gi|269469114|gb|EEZ80662.1| 1 3 16 IAENGAVVPM[147]TVDASK Gamma sulfur oxidizers_sulfur oxidation protein SoxY Unassigned 80a 45.934 -130.0138 1450 gi|269469114|gb|EEZ80662.1| 1 3 16 TSPVDALVTAGGATTK Gamma sulfur oxidizers_sulfur oxidation protein SoxY Unassigned 37a 45.934 -130.0138 1450 gi|118602123|ref|YP_903338.1| 1 3 15 FEAFGSAGNADK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 37a 45.934 -130.0138 1450 gi|118602123|ref|YP_903338.1| 1 3 15 LDLDMLLTSVEEAADFVK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 37a 45.934 -130.0138 1450 gi|118602123|ref|YP_903338.1| 1 3 15 LDLDM[147]LLTSVEEAADFVK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 56a 45.934 -130.0138 1450 gi|260072550|gb|ACX30450.1| 1 2 15 DSPILILDEATSALDSATEK Gamma sulfur oxidizers_ABC-type multidrug transporter ATPase and permease component Environmental Information Processing; Membrane Transport; ABC transporters 56a 45.934 -130.0138 1450 gi|260072550|gb|ACX30450.1| 1 2 15 SQIAFVDQNVR Gamma sulfur oxidizers_ABC-type multidrug transporter ATPase and permease component Environmental Information Processing; Membrane Transport; ABC transporters 4 45.934 -130.0138 1450 gi|118602142|ref|YP_903357.1| 1 1 14 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase; beta subunit Metabolism; Energy Metabolism; Sulfur metabolism 4 45.934 -130.0138 1450 gi|148244257|ref|YP_001218951.1| 1 1 14 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase; beta subunit Metabolism; Energy Metabolism; Sulfur metabolism 4 45.934 -130.0138 1450 gi|269469205|gb|EEZ80741.1| 1 1 14 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase; beta subunit Metabolism; Energy Metabolism; Sulfur metabolism 4 45.934 -130.0138 1450 gi|291614177|ref|YP_003524334.1| 1 1 14 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase; beta subunit Metabolism; Energy Metabolism; Sulfur metabolism 4 45.934 -130.0138 1450 gi|356960666|ref|ZP_09063648.1| 1 1 14 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase; beta subunit Metabolism; Energy Metabolism; Sulfur metabolism 186 45.934 -130.0138 1450 gi|118602789|ref|YP_904004.1| 0.9526 1 14 QLEEAGASVELK Gamma sulfur oxidizers_50S ribosomal protein L7/L12 Genetic Information Processing; Translation; Ribosome 186 45.934 -130.0138 1450 gi|269469119|gb|EEZ80667.1| 0.9526 1 14 QLEEAGASVELK Gamma sulfur oxidizers_50S ribosomal protein L7/L12 Genetic Information Processing; Translation; Ribosome 51a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 IDLSQEVSNSVYR Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 51a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 TIILANAYR Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 51a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 KNVIVDSYVK Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 51a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 TIADVVSGER Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 55a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 14 VNELGVAEPIIQQQGLER Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing; Folding; Sorting and Degradation; Protein export 55a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 14 IVVQLPGVQDTAR Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing; Folding; Sorting and Degradation; Protein export 55a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 14 EILGAVATLEFR Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing; Folding; Sorting and Degradation; Protein export 55a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 14 AGSLSAPIEIIEER Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing; Folding; Sorting and Degradation; Protein export 88a 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 1 6 14 DRGEDALIVYDDLTK Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88a 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 1 6 14 EAYPGDVFYLHSR Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88a 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 1 6 14 TEGTVVSVTDGIVR Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88a 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 1 6 14 GEDALIVYDDLTK Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88a 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 1 6 14 ELAAFAQFASDLDESTR Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88a 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 1 6 14 TAVAVDAIINQK Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 14 45.934 -130.0138 1450 gi|269468018|gb|EEZ79743.1| 1 3 13 LGQGELAGILGATEDENIQGETQK Gamma sulfur oxidizers_fructose-1;6-bisphosphatase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 14 45.934 -130.0138 1450 gi|269468018|gb|EEZ79743.1| 1 3 13 QVAAGYVLYGPSTLLVMTTGK Gamma sulfur oxidizers_fructose-1;6-bisphosphatase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 14 45.934 -130.0138 1450 gi|269468018|gb|EEZ79743.1| 1 3 13 MLDVISNDLLK Gamma sulfur oxidizers_fructose-1;6-bisphosphatase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 97 45.934 -130.0138 1450 gi|269468568|gb|EEZ80217.1| 0.9999 2 13 DQAAEIIANAGR Gamma sulfur oxidizers_F0F1-type ATP synthase; subunit b Metabolism; Energy Metabolism; Oxidative phosphorylation 97 45.934 -130.0138 1450 gi|269468568|gb|EEZ80217.1| 0.9999 2 13 FIWPPIVAAMDER Gamma sulfur oxidizers_F0F1-type ATP synthase; subunit b Metabolism; Energy Metabolism; Oxidative phosphorylation 78a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 4 13 GSAQALVEALEELSTDEVR Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 78a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 4 13 IEYYSIIYNLIDDVK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 78a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 4 13 AIMSGLLSPALSENIIGIANVK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 78a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 4 13 MEEGDVSTVNVLLK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 84a 45.934 -130.0138 1450 gi|269469149|gb|EEZ80694.1| 1 3 13 FSMPIVTFIDTPGAYPGIGAEER Gamma sulfur oxidizers_acetyl-CoA carboxylase alpha subunit Metabolism; Lipid; carbohydrate; or Terpenoids and Polyketides 84a 45.934 -130.0138 1450 gi|269469149|gb|EEZ80694.1| 1 3 13 MNLDYLDFEQPIADLEGK Gamma sulfur oxidizers_acetyl-CoA carboxylase alpha subunit Metabolism; Lipid; carbohydrate; or Terpenoids and Polyketides 84a 45.934 -130.0138 1450 gi|269469149|gb|EEZ80694.1| 1 3 13 M[147]NLDYLDFEQPIADLEGK Gamma sulfur oxidizers_acetyl-CoA carboxylase alpha subunit Metabolism; Lipid; carbohydrate; or Terpenoids and Polyketides 89a 45.934 -130.0138 1450 gi|344261379|gb|EGW21650.1| 1 3 13 GFLAAYDINTGELAWK Methylotrophs_PQQ-dependent dehydrogenase; methanol/ethanol family Metabolism; Energy metabolism; Methane metabolism 89a 45.934 -130.0138 1450 gi|344261379|gb|EGW21650.1| 1 3 13 IFLQQSDTVLTALDAK Methylotrophs_PQQ-dependent dehydrogenase; methanol/ethanol family Metabolism; Energy metabolism; Methane metabolism 89a 45.934 -130.0138 1450 gi|344261379|gb|EGW21650.1| 1 3 13 WSMSLWAR Methylotrophs_PQQ-dependent dehydrogenase; methanol/ethanol family Metabolism; Energy metabolism; Methane metabolism 69b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 3 12 FLSQPFFVAEVFTGSPGK SAR11_atpD gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 69b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 3 12 QIAEIGIYPAVDPLDSTSR SAR11_atpD gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 69b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 3 12 DIIAILGMDELSEEDK SAR11_atpD gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 69b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 3 12 FLSQPFFVAEVFTGSPGK SAR11_atpD gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 69b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 3 12 QIAEIGIYPAVDPLDSTSR SAR11_atpD gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 69b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 3 12 DIIAILGMDELSEEDK SAR11_atpD gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 17 45.934 -130.0138 1450 gi|269468173|gb|EEZ79872.1| 1 3 11 FEAFGSAGNADK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 17 45.934 -130.0138 1450 gi|269468173|gb|EEZ79872.1| 1 3 11 HLIENTSNFDPRK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 17 45.934 -130.0138 1450 gi|269468173|gb|EEZ79872.1| 1 3 11 HLIENTSNFDPR Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate metabolism; glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 23 45.934 -130.0138 1450 gi|269468231|gb|EEZ79921.1| 1 2 11 DLADVEYVLGEPIGR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 23 45.934 -130.0138 1450 gi|269468231|gb|EEZ79921.1| 1 2 11 LSAPIYAM[147]M[147]GVDDLLLR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 147 45.934 -130.0138 1450 gi|269468075|gb|EEZ79789.1| 0.9949 1 11 TTEVDGYSAVQVTTGAK Gamma sulfur oxidizers_ribosomal protein L3 Genetic Information Processing; Translation; Ribosome 58a 45.934 -130.0138 1450 gi|269467777|gb|EEZ79538.1| 1 3 11 IPTAPTPLTQTGVVMR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrM Unassigned 58a 45.934 -130.0138 1450 gi|269467777|gb|EEZ79538.1| 1 3 11 HISPWALK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrM Unassigned 58a 45.934 -130.0138 1450 gi|269467777|gb|EEZ79538.1| 1 3 11 EVVLFESLFK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrM Unassigned 83a 45.934 -130.0138 1450 gi|269469122|gb|EEZ80670.1| 1 3 11 TPPAALLILK Gamma sulfur oxidizers_ribosomal protein L11 Genetic Information Processing; Translation; Ribosome 83a 45.934 -130.0138 1450 gi|269469122|gb|EEZ80670.1| 1 3 11 VPVVITVYNDR Gamma sulfur oxidizers_ribosomal protein L11 Genetic Information Processing; Translation; Ribosome 83a 45.934 -130.0138 1450 gi|269469122|gb|EEZ80670.1| 1 3 11 AQLEEVAAIK Gamma sulfur oxidizers_ribosomal protein L11 Genetic Information Processing; Translation; Ribosome 6 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 1 3 10 DQGVDLTNDPMALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 6 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 1 3 10 DQGVDLTNDPM[147]ALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 6 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 1 3 10 DQGVDLTNDPMALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 6 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 1 3 10 DQGVDLTNDPM[147]ALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 6 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 3 10 QAVTNPENTLYAIK Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 24 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 3 10 GIILSGGPDTVTTDDSAR Gamma sulfur oxidizers_GMP synthase; PP-ATPase domain/subunit Metabolism; Nucleotide Metabolism; Purine metabolism 24 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 3 10 LPYDFLDFVSNR Gamma sulfur oxidizers_GMP synthase; PP-ATPase domain/subunit Metabolism; Nucleotide Metabolism; Purine metabolism 24 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 3 10 FYDALADEADPEK Gamma sulfur oxidizers_GMP synthase; PP-ATPase domain/subunit Metabolism; Nucleotide Metabolism; Purine metabolism 159 45.934 -130.0138 1450 gi|269468809|gb|EEZ80413.1| 0.9865 3 10 GVLEVAGISR Gamma sulfur oxidizers_hypothetical protein Sup05_0849 Unassigned 159 45.934 -130.0138 1450 gi|269468809|gb|EEZ80413.1| 0.9865 3 10 TIYNFCNGAWCGQSPASIR Gamma sulfur oxidizers_hypothetical protein Sup05_0849 Unassigned 159 45.934 -130.0138 1450 gi|269468809|gb|EEZ80413.1| 0.9865 3 10 KGTIPHAINVPFTK Gamma sulfur oxidizers_hypothetical protein Sup05_0849 Unassigned 39a 45.934 -130.0138 1450 gi|118602219|ref|YP_903434.1| 1 3 10 ADVDYSSYGANTQYGVIGIK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing; Translation; Ribosome 39a 45.934 -130.0138 1450 gi|118602219|ref|YP_903434.1| 1 3 10 LVAENIAQQLEK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing; Translation; Ribosome 39a 45.934 -130.0138 1450 gi|118602219|ref|YP_903434.1| 1 3 10 WYANSQDYSK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing; Translation; Ribosome 39a 45.934 -130.0138 1450 gi|269468081|gb|EEZ79795.1| 1 3 10 ADVDYSSYGANTQYGVIGIK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing; Translation; Ribosome 39a 45.934 -130.0138 1450 gi|269468081|gb|EEZ79795.1| 1 3 10 LVAENIAQQLEK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing; Translation; Ribosome 39a 45.934 -130.0138 1450 gi|269468081|gb|EEZ79795.1| 1 3 10 WYANSQDYSK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing; Translation; Ribosome 53a 45.934 -130.0138 1450 gi|148244929|ref|YP_001219623.1| 1 2 10 ISGLGQLIEAGIQSDR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing; Folding; Sorting and Degradation; Sulfur relay system 53a 45.934 -130.0138 1450 gi|148244929|ref|YP_001219623.1| 1 2 10 VFFYHDGVNNASR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing; Folding; Sorting and Degradation; Sulfur relay system 53a 45.934 -130.0138 1450 gi|269467773|gb|EEZ79534.1| 1 2 10 ISGLGQLIEAGIQSDR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing; Folding; Sorting and Degradation; Sulfur relay system 53a 45.934 -130.0138 1450 gi|269467773|gb|EEZ79534.1| 1 2 10 VFFYHDGVNNASR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing; Folding; Sorting and Degradation; Sulfur relay system 63a 45.934 -130.0138 1450 gi|269468206|gb|EEZ79899.1| 1 3 10 MNSMPLGSAALAGTTYPINR Gamma sulfur oxidizers_argininosuccinate lyase Metabolism; Amino Acid Metabolism; Alanine; aspartate and glutamate or Arginine and proline metabolism 63a 45.934 -130.0138 1450 gi|269468206|gb|EEZ79899.1| 1 3 10 VYGNLTSLLTIMK Gamma sulfur oxidizers_argininosuccinate lyase Metabolism; Amino Acid Metabolism; Alanine; aspartate and glutamate or Arginine and proline metabolism 63a 45.934 -130.0138 1450 gi|269468206|gb|EEZ79899.1| 1 3 10 DAHEVVGQSVSYGIEHQK Gamma sulfur oxidizers_argininosuccinate lyase Metabolism; Amino Acid Metabolism; Alanine; aspartate and glutamate or Arginine and proline metabolism 65a 45.934 -130.0138 1450 gi|269468320|gb|EEZ79996.1| 1 2 10 VLSDIAIFDKPAFAQIADQAK Gamma sulfur oxidizers_ribosomal protein L20 Genetic Information Processing; Translation; Ribosome 65a 45.934 -130.0138 1450 gi|269468320|gb|EEZ79996.1| 1 2 10 VLSDIAIFDK Gamma sulfur oxidizers_ribosomal protein L20 Genetic Information Processing; Translation; Ribosome 3 45.934 -130.0138 1450 gi|118602070|ref|YP_903285.1| 1 1 9 VWNEHLAEYYTPR Gamma sulfur oxidizers_cytochrome b/b6 domain-containing protein Metabolism; Energy Metabolism; Oxidative phosphorylation or nitrogen metabolism 3 45.934 -130.0138 1450 gi|148244180|ref|YP_001218874.1| 1 1 9 VWNEHLAEYYTPR Gamma sulfur oxidizers_cytochrome b/b6 domain-containing protein Metabolism; Energy Metabolism; Oxidative phosphorylation or nitrogen metabolism 9 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 9 SIDDGLGNTLLSHADAK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 9 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 9 EVVTGIVTGAVK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 9 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 9 GQELEVVILNIDAEKER Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 9 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 9 AFLPGSLVDVRPVK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 9 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 9 DFSYLTGQEIEAIVIK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 9 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 9 GGLTVDIGVVK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 26 45.934 -130.0138 1450 gi|269468463|gb|EEZ80124.1| 1 2 9 DQALETEMLYR Gamma sulfur oxidizers_hypothetical protein Sup05_0570 Unassigned 26 45.934 -130.0138 1450 gi|269468463|gb|EEZ80124.1| 1 2 9 DQALETEM[147]LYR Gamma sulfur oxidizers_hypothetical protein Sup05_0570 Unassigned 27 45.934 -130.0138 1450 gi|269468484|gb|EEZ80145.1| 1 3 9 DLVNAIPYVAIQQGLLTVEK Gamma sulfur oxidizers_aconitase B Metabolism; Carbohydrate Metabolism 27 45.934 -130.0138 1450 gi|269468484|gb|EEZ80145.1| 1 3 9 MTTVGSQDTTGAMTR Gamma sulfur oxidizers_aconitase B Metabolism; Carbohydrate Metabolism 27 45.934 -130.0138 1450 gi|269468484|gb|EEZ80145.1| 1 3 9 IEQAFELTDASAER Gamma sulfur oxidizers_aconitase B Metabolism; Carbohydrate Metabolism 208 45.934 -130.0138 1450 gi|118602068|ref|YP_903283.1| 0.9224 1 9 FPFPPLLPVDPIEK Gamma sulfur oxidizers_hypothetical protein Sup05_0570 Unassigned 42a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 1 6 9 MEEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 1 6 9 QLGIYSASGQLYQPEDSDK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 1 6 9 YEVLGTDGFGR Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 1 6 9 IIQELEGMFR Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 1 6 9 M[147]EEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 1 6 9 VGDLAWAAGDMQAK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 1 6 9 MEEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 1 6 9 QLGIYSASGQLYQPEDSDK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 1 6 9 YEVLGTDGFGR Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 1 6 9 IIQELEGMFR Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 1 6 9 M[147]EEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 42a 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 1 6 9 VGDLAWAAGDMQAK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism; Carbohydrate Metabolism; Citrate cycle (TCA cycle) glycolysis; and pyruvate metabolism or Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 62a 45.934 -130.0138 1450 gi|269468017|gb|EEZ79742.1| 1 3 9 IFVLEVMGR Gamma sulfur oxidizers_6-phosphofructokinase Metabolism; Carbohydrate Metabolism; 62a 45.934 -130.0138 1450 gi|269468017|gb|EEZ79742.1| 1 3 9 TSNNPYTWEIGSGELK Gamma sulfur oxidizers_6-phosphofructokinase Metabolism; Carbohydrate Metabolism; 62a 45.934 -130.0138 1450 gi|269468017|gb|EEZ79742.1| 1 3 9 HLASESDVEQAYALGEAAVNMALEGK Gamma sulfur oxidizers_6-phosphofructokinase Metabolism; Carbohydrate Metabolism; 85a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 1 4 9 QGSLLDFIADFVK Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism; Energy Metabolism; Oxidative phosphorylation 85a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 1 4 9 APGFAHLAAMDEMAR Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism; Energy Metabolism; Oxidative phosphorylation 85a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 1 4 9 LVNIGIVSANR Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism; Energy Metabolism; Oxidative phosphorylation 85a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 1 4 9 MPQYLESDFR Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism; Energy Metabolism; Oxidative phosphorylation 11 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 3 8 LFPTSVAYLLTDFLVK Gamma sulfur oxidizers_topoisomerase IA Unassigned 11 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 3 8 TDSFTLSEEAIAAAQK Gamma sulfur oxidizers_topoisomerase IA Unassigned 11 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 3 8 TVNFDVVDAQQAR Gamma sulfur oxidizers_topoisomerase IA Unassigned 11 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 3 8 LFPTSVAYLLTDFLVK Gamma sulfur oxidizers_topoisomerase IA Unassigned 11 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 3 8 TDSFTLSEEAIAAAQK Gamma sulfur oxidizers_topoisomerase IA Unassigned 11 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 3 8 TVNFDVVDAQQAR Gamma sulfur oxidizers_topoisomerase IA Unassigned 12 45.934 -130.0138 1450 gi|269467791|gb|EEZ79549.1| 1 2 8 MDALEPMLINMEEMNK Gamma sulfur oxidizers_hypothetical protein Sup05_0786 Unassigned 12 45.934 -130.0138 1450 gi|269467791|gb|EEZ79549.1| 1 2 8 LANSMDPNMGGNMSAMVSSIEK Gamma sulfur oxidizers_hypothetical protein Sup05_0786 Unassigned 15 45.934 -130.0138 1450 gi|269468080|gb|EEZ79794.1| 1 2 8 VLNSAISNAEHNDGLDIDELK Gamma sulfur oxidizers_ribosomal protein L22 Genetic Information Processing; Translation; Ribosome 15 45.934 -130.0138 1450 gi|269468080|gb|EEZ79794.1| 1 2 8 KVLNSAISNAEHNDGLDIDELK Gamma sulfur oxidizers_ribosomal protein L22 Genetic Information Processing; Translation; Ribosome 137 45.934 -130.0138 1450 gi|148244179|ref|YP_001218873.1| 0.9949 1 8 DITNFLDYVGEPAK Gamma sulfur oxidizers_ubiquinol-cytochrome c reductase cytochrome c1 subunit Metabolism; Energy metabolism; Oxidative phosphorylation 138 45.934 -130.0138 1450 gi|148244649|ref|YP_001219343.1| 0.9949 1 8 NINKGDVVQPGQILIK Gamma sulfur oxidizers_multidrug efflux system Unassigned 166 45.934 -130.0138 1450 gi|269468482|gb|EEZ80143.1| 0.9722 1 8 IGYFNPVAR Gamma sulfur oxidizers_ribosomal protein S16 Genetic Information Processing; Translation; Ribosome 166 45.934 -130.0138 1450 gi|356960569|ref|ZP_09063551.1| 0.9722 1 8 IGYFNPVAR Gamma sulfur oxidizers_ribosomal protein S16 Genetic Information Processing; Translation; Ribosome 41a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 3 8 IQIGTISQFGLLEMSR Gamma sulfur oxidizers_ribonuclease Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 41a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 3 8 VEQSLEAAFVDYGK Gamma sulfur oxidizers_ribonuclease Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 41a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 3 8 ITLLPNPYMQFPNFTINK Gamma sulfur oxidizers_ribonuclease Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 70a 45.934 -130.0138 1450 gi|269468602|gb|EEZ80246.1| 1 3 8 LMQEELLEYGNAK Gamma sulfur oxidizers_phosphoserine aminotransferase Metabolism; Energy Metabolism; Methane metabolism or Amino Acid Metabolism; Glycine; serine and threonine metabolism or Metabolism of Cofactors and Vitamins; Vitamin B6 metabolism 70a 45.934 -130.0138 1450 gi|269468602|gb|EEZ80246.1| 1 3 8 ASIYNAMPQEGIDSLVSFMK Gamma sulfur oxidizers_phosphoserine aminotransferase Metabolism; Energy Metabolism; Methane metabolism or Amino Acid Metabolism; Glycine; serine and threonine metabolism or Metabolism of Cofactors and Vitamins; Vitamin B6 metabolism 70a 45.934 -130.0138 1450 gi|269468602|gb|EEZ80246.1| 1 3 8 YGVIYAGAQK Gamma sulfur oxidizers_phosphoserine aminotransferase Metabolism; Energy Metabolism; Methane metabolism or Amino Acid Metabolism; Glycine; serine and threonine metabolism or Metabolism of Cofactors and Vitamins; Vitamin B6 metabolism 71a 45.934 -130.0138 1450 gi|269468785|gb|EEZ80389.1| 1 3 8 IVNEALGNLR Gamma sulfur oxidizers_aspartyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 71a 45.934 -130.0138 1450 gi|269468785|gb|EEZ80389.1| 1 3 8 VIEMTGAQTGDIIFFGADK Gamma sulfur oxidizers_aspartyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 71a 45.934 -130.0138 1450 gi|269468785|gb|EEZ80389.1| 1 3 8 LNEDGPASPILK Gamma sulfur oxidizers_aspartyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 7 45.934 -130.0138 1450 gi|118602578|ref|YP_903793.1| 1 2 7 GPMVTQALEQMLR Gamma sulfur oxidizers_hypothetical protein Rmag_0571 Unassigned 7 45.934 -130.0138 1450 gi|118602578|ref|YP_903793.1| 1 2 7 IPVSGSVIVTTPQDIALIDAK Gamma sulfur oxidizers_hypothetical protein Rmag_0571 Unassigned 19 45.934 -130.0138 1450 gi|269468178|gb|EEZ79877.1| 1 3 7 AVFENIIPSSTGAAK Gamma sulfur oxidizers_glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase Metabolism; Carbohydrate Metabolism; Glycolysis / Gluconeogenesis 19 45.934 -130.0138 1450 gi|269468178|gb|EEZ79877.1| 1 3 7 GLMTTVHASTATQK Gamma sulfur oxidizers_glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase Metabolism; Carbohydrate Metabolism; Glycolysis / Gluconeogenesis 19 45.934 -130.0138 1450 gi|269468178|gb|EEZ79877.1| 1 3 7 GTLAYTEDMVVSSDFR Gamma sulfur oxidizers_glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase Metabolism; Carbohydrate Metabolism; Glycolysis / Gluconeogenesis 21 45.934 -130.0138 1450 gi|269468221|gb|EEZ79911.1| 1 3 7 SIEILGLDAISR Gamma sulfur oxidizers_outer membrane protein/protective antigen OMA87 Unassigned 21 45.934 -130.0138 1450 gi|269468221|gb|EEZ79911.1| 1 3 7 GGELSLLAGTSIISPMK Gamma sulfur oxidizers_outer membrane protein/protective antigen OMA87 Unassigned 21 45.934 -130.0138 1450 gi|269468221|gb|EEZ79911.1| 1 3 7 GGELSLLAGTSIISPM[147]K Gamma sulfur oxidizers_outer membrane protein/protective antigen OMA87 Unassigned 96 45.934 -130.0138 1450 gi|269468408|gb|EEZ80073.1| 0.9999 3 7 FSDFGLSDSILK Gamma sulfur oxidizers_hypothetical protein Sup05_1317 Genetic Information Processing; Folding; sorting and degradation; RNA degradation 96 45.934 -130.0138 1450 gi|269468408|gb|EEZ80073.1| 0.9999 3 7 SFVLDEADEMLK Gamma sulfur oxidizers_hypothetical protein Sup05_1317 Genetic Information Processing; Folding; sorting and degradation; RNA degradation 96 45.934 -130.0138 1450 gi|269468408|gb|EEZ80073.1| 0.9999 3 7 ISHVVNYDIPQDAETYVHR Gamma sulfur oxidizers_hypothetical protein Sup05_1317 Genetic Information Processing; Folding; sorting and degradation; RNA degradation 101 45.934 -130.0138 1450 gi|269468819|gb|EEZ80423.1| 0.9998 2 7 AFDQGLNPIVVINK Gamma sulfur oxidizers_membrane GTPase Unassigned 101 45.934 -130.0138 1450 gi|269468819|gb|EEZ80423.1| 0.9998 2 7 LLEQSQTFDDR Gamma sulfur oxidizers_membrane GTPase Unassigned 127 45.934 -130.0138 1450 gi|118602175|ref|YP_903390.1| 0.9949 1 7 AVEWLGELADAAQK Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned; Cellular Processes and Signaling; Inorganic ion transport and metabolism 127 45.934 -130.0138 1450 gi|269469152|gb|EEZ80697.1| 0.9949 1 7 AVEWLGELADAAQK Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned; Cellular Processes and Signaling; Inorganic ion transport and metabolism 128 45.934 -130.0138 1450 gi|118602232|ref|YP_903447.1| 0.9949 1 7 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing; Translation; Ribosome 128 45.934 -130.0138 1450 gi|291613255|ref|YP_003523412.1| 0.9949 1 7 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing; Translation; Ribosome 128 45.934 -130.0138 1450 gi|302877820|ref|YP_003846384.1| 0.9949 1 7 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing; Translation; Ribosome 128 45.934 -130.0138 1450 gi|344262228|gb|EGW22499.1| 0.9949 1 7 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing; Translation; Ribosome 128 45.934 -130.0138 1450 gi|357406656|ref|YP_004918580.1| 0.9949 1 7 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing; Translation; Ribosome 153 45.934 -130.0138 1450 gi|269468867|gb|EEZ80462.1| 0.9949 1 7 WLNNTDFGLNFDTK Gamma sulfur oxidizers_hypothetical protein Sup05_0003 Unassigned 153 45.934 -130.0138 1450 gi|269469067|gb|EEZ80622.1| 0.9949 1 7 WLNNTDFGLNFDTK Gamma sulfur oxidizers_hypothetical protein Sup05_0003 Unassigned 177 45.934 -130.0138 1450 gi|148244379|ref|YP_001219073.1| 0.9616 1 7 ILDVISTDAGSVK Gamma sulfur oxidizers_hypothetical protein COSY_0219 Genetic Information Processing; Folding; sorting and degradation; Sulfur relay system 194 45.934 -130.0138 1450 gi|118602119|ref|YP_903334.1| 0.9391 1 7 AEFPADAAEFER Gamma sulfur oxidizers_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 112a 45.934 -130.0138 1450 gi|148244204|ref|YP_001218898.1| 0.9993 2 7 VFNWISTMWR Gamma sulfur oxidizers_cytochrome c oxidase subunit I Metabolism; Energy Metabolism; Oxidative phosphorylation 112a 45.934 -130.0138 1450 gi|148244204|ref|YP_001218898.1| 0.9993 2 7 GLEWTLEPK Gamma sulfur oxidizers_cytochrome c oxidase subunit I Metabolism; Energy Metabolism; Oxidative phosphorylation 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 GLMAKPDGSIIETPITSNFR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 LLELDAPEIIVR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 NTDPLTGLTFFEMIDEAER Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 VADLFEAR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 AMMDEIGFEDFIDADGK Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 FATSDLNDLYR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 MALELFKPFIYNR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 TSDITGGLPR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 9 7 M[147]GHIELAAPVAHIWYLK Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 5 45.934 -130.0138 1450 gi|118602355|ref|YP_903570.1| 1 2 6 KMEEMGVNDNYIQGWVAGFLNNPEIEEQR Gamma sulfur oxidizers_hypothetical protein Rmag_0321 Unassigned 5 45.934 -130.0138 1450 gi|118602355|ref|YP_903570.1| 1 2 6 MEEMGVNDNYIQGWVAGFLNNPEIEEQR Gamma sulfur oxidizers_hypothetical protein Rmag_0321 Unassigned 5 45.934 -130.0138 1450 gi|148244459|ref|YP_001219153.1| 1 2 6 KMEEMGVNDNYIQGWVAGFLNNPEIEEQR Gamma sulfur oxidizers_hypothetical protein Rmag_0321 Unassigned 5 45.934 -130.0138 1450 gi|148244459|ref|YP_001219153.1| 1 2 6 MEEMGVNDNYIQGWVAGFLNNPEIEEQR Gamma sulfur oxidizers_hypothetical protein Rmag_0321 Unassigned 13 45.934 -130.0138 1450 gi|269467813|gb|EEZ79565.1| 1 1 6 SELIDAIASAANLSK Gamma sulfur oxidizers_histone family protein Unassigned 16 45.934 -130.0138 1450 gi|269468086|gb|EEZ79800.1| 1 2 6 LLAMFNFPFK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing; Translation; Ribosome 16 45.934 -130.0138 1450 gi|269468086|gb|EEZ79800.1| 1 2 6 LLAM[147]FNFPFK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing; Translation; Ribosome 16 45.934 -130.0138 1450 gi|356960602|ref|ZP_09063584.1| 1 2 6 LLAMFNFPFK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing; Translation; Ribosome 16 45.934 -130.0138 1450 gi|356960602|ref|ZP_09063584.1| 1 2 6 LLAM[147]FNFPFK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing; Translation; Ribosome 30 45.934 -130.0138 1450 gi|269469077|gb|EEZ80632.1| 1 2 6 DLEFLAEENFTQFGK Gamma sulfur oxidizers_ribosomal protein S2 Genetic Information Processing; Translation; Ribosome 30 45.934 -130.0138 1450 gi|269469077|gb|EEZ80632.1| 1 2 6 LKDLEFLAEENFTQFGK Gamma sulfur oxidizers_ribosomal protein S2 Genetic Information Processing; Translation; Ribosome 33 45.934 -130.0138 1450 gi|269469155|gb|EEZ80700.1| 1 3 6 TAGFTLPILQLLSK Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 33 45.934 -130.0138 1450 gi|269469155|gb|EEZ80700.1| 1 3 6 ELAAQVQDSVATYGK Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 33 45.934 -130.0138 1450 gi|269469155|gb|EEZ80700.1| 1 3 6 DLMAAAQTGTGK Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 106 45.934 -130.0138 1450 gi|118602382|ref|YP_903597.1| 0.9997 2 6 TLNGLILETLQSIPK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 Unassigned 106 45.934 -130.0138 1450 gi|118602382|ref|YP_903597.1| 0.9997 2 6 MLLNIIDLEK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 Unassigned 106 45.934 -130.0138 1450 gi|148244486|ref|YP_001219180.1| 0.9997 2 6 TLNGLILETLQSIPK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 Unassigned 106 45.934 -130.0138 1450 gi|148244486|ref|YP_001219180.1| 0.9997 2 6 MLLNIIDLEK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 Unassigned 106 45.934 -130.0138 1450 gi|269467802|gb|EEZ79557.1| 0.9997 2 6 TLNGLILETLQSIPK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 Unassigned 106 45.934 -130.0138 1450 gi|269467802|gb|EEZ79557.1| 0.9997 2 6 MLLNIIDLEK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 Unassigned 131 45.934 -130.0138 1450 gi|118602772|ref|YP_903987.1| 0.9949 1 6 GSLESTVIAVGQDAK Gamma sulfur oxidizers_rod shape-determining protein MreB Unassigned 131 45.934 -130.0138 1450 gi|269468196|gb|EEZ79889.1| 0.9949 1 6 GSLESTVIAVGQDAK Gamma sulfur oxidizers_rod shape-determining protein MreB Unassigned 136 45.934 -130.0138 1450 gi|118603009|ref|YP_904224.1| 0.9949 1 6 IESGLLAAER Gamma sulfur oxidizers_ATP synthase F0; B subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 197 45.934 -130.0138 1450 gi|269468609|gb|EEZ80253.1| 0.935 1 6 FWGFVPEEYIIGK Gamma sulfur oxidizers_signal peptidase I Genetic Information Processing; Folding; Sorting and Degradation; Protein export 103a 45.934 -130.0138 1450 gi|148244239|ref|YP_001218933.1| 0.9998 2 6 ADYVALSFPVSGDDVR Gamma sulfur oxidizers_pyruvate kinase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism; Glycolysis / Gluconeogenesis; or pyruvate metabolism or Nucleotide Metabolism; Purine metabolism 103a 45.934 -130.0138 1450 gi|148244239|ref|YP_001218933.1| 0.9998 2 6 GDLGVEIGDAQLPAQQK Gamma sulfur oxidizers_pyruvate kinase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism; Glycolysis / Gluconeogenesis; or pyruvate metabolism or Nucleotide Metabolism; Purine metabolism 38b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 1 5 6 ADMVDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 1 5 6 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 1 5 6 ADM[147]VDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 1 5 6 TTDVTGACQLPDGIEMVMPGDNVK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 1 5 6 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 1 5 6 ADMVDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 1 5 6 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 1 5 6 ADM[147]VDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 1 5 6 TTDVTGACQLPDGIEMVMPGDNVK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 38b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 1 5 6 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 48a 45.934 -130.0138 1450 gi|118602839|ref|YP_904054.1| 1 2 6 LYVSAESLEER Gamma sulfur oxidizers_DsrE family protein Genetic Information Processing; Folding; Sorting and Degradation; Sulfur relay system 48a 45.934 -130.0138 1450 gi|118602839|ref|YP_904054.1| 1 2 6 TFHALGDYDINK Gamma sulfur oxidizers_DsrE family protein Genetic Information Processing; Folding; Sorting and Degradation; Sulfur relay system 64a 45.934 -130.0138 1450 gi|269468318|gb|EEZ79994.1| 1 3 6 GIKWDLQEGEGAFYGPK Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 64a 45.934 -130.0138 1450 gi|269468318|gb|EEZ79994.1| 1 3 6 GWTLYQIVEQYMR Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 64a 45.934 -130.0138 1450 gi|269468318|gb|EEZ79994.1| 1 3 6 AEAALAEALDAK Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 73a 45.934 -130.0138 1450 gi|269468886|gb|EEZ80478.1| 0.9827 2 6 AGNTSLEELVMAVR Gamma sulfur oxidizers_2-isopropylmalate synthase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 73a 45.934 -130.0138 1450 gi|269468886|gb|EEZ80478.1| 0.9827 2 6 IINGQGADTDIITASAK Gamma sulfur oxidizers_2-isopropylmalate synthase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 74b 45.934 -130.0138 1450 gi|118602160|ref|YP_903375.1| 0.9993 3 6 GLQFLDLIQEGNVGLMK Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74b 45.934 -130.0138 1450 gi|118602160|ref|YP_903375.1| 0.9993 3 6 AQSTSAEAAIAALAALDSEFGR Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74b 45.934 -130.0138 1450 gi|118602160|ref|YP_903375.1| 0.9993 3 6 IPVHMIETINK Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74b 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 0.9993 3 6 GLQFLDLIQEGNVGLMK Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74b 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 0.9993 3 6 AQSTSAEAAIAALAALDSEFGR Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74b 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 0.9993 3 6 IPVHMIETINK Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 QIASVAASLIPFLEHDDANR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 STGPYSLVTQQPLSGK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 FGEMEVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 EFFGSSQLSQFMDQVNPLSGVTHK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 FGEM[147]EVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 LDEVGVVYVGAR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 EGLNLAETDELTPQDLINSKPVSAAVR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 81b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 0.9997 8 6 ISALGPGGLTR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing; Transcription; RNA polymerase 98a 45.934 -130.0138 1450 gi|118602264|ref|YP_903479.1| 0.9999 2 6 MVSSGTEATMSAIR Gamma sulfur oxidizers_glutamate-1-semialdehyde aminotransferase Metabolism; Metabolism of Cofactors and Vitamins; Porphyrin and chlorophyll metabolism 98a 45.934 -130.0138 1450 gi|118602264|ref|YP_903479.1| 0.9999 2 6 VIGGGLPVGAFGGK Gamma sulfur oxidizers_glutamate-1-semialdehyde aminotransferase Metabolism; Metabolism of Cofactors and Vitamins; Porphyrin and chlorophyll metabolism 98a 45.934 -130.0138 1450 gi|269468273|gb|EEZ79957.1| 0.9999 2 6 MVSSGTEATMSAIR Gamma sulfur oxidizers_glutamate-1-semialdehyde aminotransferase Metabolism; Metabolism of Cofactors and Vitamins; Porphyrin and chlorophyll metabolism 98a 45.934 -130.0138 1450 gi|269468273|gb|EEZ79957.1| 0.9999 2 6 VIGGGLPVGAFGGK Gamma sulfur oxidizers_glutamate-1-semialdehyde aminotransferase Metabolism; Metabolism of Cofactors and Vitamins; Porphyrin and chlorophyll metabolism 25 45.934 -130.0138 1450 gi|269468409|gb|EEZ80074.1| 1 1 5 GFGFIEQESGDDVFVHFR Gamma sulfur oxidizers_cold shock protein Unassigned (chaperonin?) 28 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 2 5 EGYEVASEVTNPDAILVR Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism; Amino Acid Metabolism; Glycine; serine and threonine metabolism 28 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 2 5 IALLPEGATILNFAR Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism; Amino Acid Metabolism; Glycine; serine and threonine metabolism 95 45.934 -130.0138 1450 gi|269468288|gb|EEZ79970.1| 0.9999 2 5 IAAVAMLVR Gamma sulfur oxidizers_NADH:ubiquinone oxidoreductase; chain N Metabolism; Energy Metabolism; Oxidative phosphorylation 95 45.934 -130.0138 1450 gi|269468288|gb|EEZ79970.1| 0.9999 2 5 GFEADQISDYK Gamma sulfur oxidizers_NADH:ubiquinone oxidoreductase; chain N Metabolism; Energy Metabolism; Oxidative phosphorylation 124 45.934 -130.0138 1450 gi|118602908|ref|YP_904123.1| 0.9957 2 5 ELAIQVSEAVQTYAR Gamma sulfur oxidizers_ATP-dependent RNA helicase DeaD Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 124 45.934 -130.0138 1450 gi|118602908|ref|YP_904123.1| 0.9957 2 5 SFVLDEADEMLK Gamma sulfur oxidizers_ATP-dependent RNA helicase DeaD Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 124 45.934 -130.0138 1450 gi|148244979|ref|YP_001219673.1| 0.9957 2 5 ELAIQVSEAVQTYAR Gamma sulfur oxidizers_ATP-dependent RNA helicase DeaD Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 124 45.934 -130.0138 1450 gi|148244979|ref|YP_001219673.1| 0.9957 2 5 SFVLDEADEMLK Gamma sulfur oxidizers_ATP-dependent RNA helicase DeaD Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 126 45.934 -130.0138 1450 gi|118602152|ref|YP_903367.1| 0.9949 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 126 45.934 -130.0138 1450 gi|148244267|ref|YP_001218961.1| 0.9949 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 126 45.934 -130.0138 1450 gi|269467958|gb|EEZ79690.1| 0.9949 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 126 45.934 -130.0138 1450 gi|269468025|gb|EEZ79748.1| 0.9949 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 126 45.934 -130.0138 1450 gi|344263257|gb|EGW23528.1| 0.9949 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 126 45.934 -130.0138 1450 gi|357407283|ref|YP_004919207.1| 0.9949 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 129 45.934 -130.0138 1450 gi|118602238|ref|YP_903453.1| 0.9949 1 5 AEQIYYIGDLIQK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit alpha Metabolism; Nucleotide metabolism 129 45.934 -130.0138 1450 gi|148244354|ref|YP_001219048.1| 0.9949 1 5 AEQIYYIGDLIQK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit alpha Metabolism; Nucleotide metabolism 135 45.934 -130.0138 1450 gi|118602966|ref|YP_904181.1| 0.9949 1 5 TGLIMGSGGASNQNVVEAADILR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism; Lipid metabolism; Fatty acid biosynthesis 140 45.934 -130.0138 1450 gi|260072624|gb|ACX30522.1| 0.9949 1 5 ALLESIADNIAIALDK Gamma sulfur oxidizers_signal transduction histidine kinase nitrate/nitrite-specific Environmental Information Processing; Signal transduction; Two-component system 140 45.934 -130.0138 1450 gi|269468661|gb|EEZ80301.1| 0.9949 1 5 ALLESIADNIAIALDK Gamma sulfur oxidizers_signal transduction histidine kinase nitrate/nitrite-specific Environmental Information Processing; Signal transduction; Two-component system 149 45.934 -130.0138 1450 gi|269468306|gb|EEZ79985.1| 0.9949 1 5 EGVLAGLGGFGAMFELPINK Gamma sulfur oxidizers_phosphoribosylaminoimidazole (AIR) synthetase Metabolism; Nucleotide Metabolism; Purine metabolism 183 45.934 -130.0138 1450 gi|357405116|ref|YP_004917040.1| 0.9559 1 5 WVLAGTDYVYPR Methylotrophs_unnamed protein product Environmental Information Processing; Membrane transport; ABC transporters 40a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9892 3 5 NILIDGQGNFGSVDGDSAAAMR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 40a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9892 3 5 YHPHGDTAVYDTIVR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 40a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9892 3 5 VLYAMEVLGNDYNK Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 40a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9892 3 5 NILIDGQGNFGSVDGDSAAAMR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 40a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9892 3 5 YHPHGDTAVYDTIVR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 40a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9892 3 5 VLYAMEVLGNDYNK Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 43a 45.934 -130.0138 1450 gi|118602489|ref|YP_903704.1| 1 3 5 GEVIASTFDESAKR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 43a 45.934 -130.0138 1450 gi|118602489|ref|YP_903704.1| 1 3 5 ILHPMDTVEAAEFLIDR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 43a 45.934 -130.0138 1450 gi|118602489|ref|YP_903704.1| 1 3 5 IFPAININASGTR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 43a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 3 5 GEVIASTFDESAKR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 43a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 3 5 ILHPMDTVEAAEFLIDR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 43a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 3 5 IFPAININASGTR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 GDVVSDGPSNPHDILR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 GLMAKPDGSIIETPITSNFR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 LLELDAPEIIVR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 VADLFEAR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 FATSDLNDLYR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 MALELFKPFIYNR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 TSDITGGLPR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 M[147]GHIELAAPVAHIWYLK Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 47b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 9 5 GHKIGVGEAVGVIAAQSIGEPGTQLTMR Gamma sulfur oxidizers_DNA-directed RNA polymerase; betaP subunit Genetic Information Processing; Transcription; RNA polymerase 68a 45.934 -130.0138 1450 gi|269468570|gb|EEZ80219.1| 1 2 5 SATDNAGDMVKDLELVYNK Gamma sulfur oxidizers_F0F1-type ATP synthase; gamma subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 68a 45.934 -130.0138 1450 gi|269468570|gb|EEZ80219.1| 1 2 5 ITSAMEMVAASK Gamma sulfur oxidizers_F0F1-type ATP synthase; gamma subunit Metabolism; Energy Metabolism; Oxidative phosphorylation 91a 45.934 -130.0138 1450 gi|356960405|ref|ZP_09063387.1| 1 2 5 ALGVTMFLPEK Gamma sulfur oxidizers_cell division protein FtsH Unassigned 91a 45.934 -130.0138 1450 gi|356960405|ref|ZP_09063387.1| 1 2 5 INSQISSLFGGR Gamma sulfur oxidizers_cell division protein FtsH Unassigned 92a 45.934 -130.0138 1450 gi|356960838|ref|ZP_09063820.1| 1 2 5 TLGIGVTNLAYYLAK Gamma sulfur oxidizers_ribonucleotide-diphosphate reductase subunit alpha Metabolism; Nucleotide Metabolism; Purine and pyrimidine metabolism 92a 45.934 -130.0138 1450 gi|356960838|ref|ZP_09063820.1| 1 2 5 SLDSLLDYQDYPLK Gamma sulfur oxidizers_ribonucleotide-diphosphate reductase subunit alpha Metabolism; Nucleotide Metabolism; Purine and pyrimidine metabolism 8 45.934 -130.0138 1450 gi|148244330|ref|YP_001219024.1| 1 2 4 DALLM[147]TDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing; Translation; Ribosome 8 45.934 -130.0138 1450 gi|148244330|ref|YP_001219024.1| 1 2 4 DALLMTDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing; Translation; Ribosome 8 45.934 -130.0138 1450 gi|269468076|gb|EEZ79790.1| 1 2 4 DALLM[147]TDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing; Translation; Ribosome 8 45.934 -130.0138 1450 gi|269468076|gb|EEZ79790.1| 1 2 4 DALLMTDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing; Translation; Ribosome 8 45.934 -130.0138 1450 gi|356960855|ref|ZP_09063837.1| 1 2 4 DALLM[147]TDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing; Translation; Ribosome 8 45.934 -130.0138 1450 gi|356960855|ref|ZP_09063837.1| 1 2 4 DALLMTDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing; Translation; Ribosome 10 45.934 -130.0138 1450 gi|148244920|ref|YP_001219614.1| 1 2 4 LILTTGTGSIFGFLVAR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrP Unassigned 10 45.934 -130.0138 1450 gi|148244920|ref|YP_001219614.1| 1 2 4 LIVAMTEYNFK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrP Unassigned 18 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 3 4 GRPTEGEASDEFTLQPVADR Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism; Glycolysis / Gluconeogenesis 18 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 3 4 KLPAVEILEQR Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism; Glycolysis / Gluconeogenesis 18 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 3 4 LTELLGVNVR Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism; Glycolysis / Gluconeogenesis 94 45.934 -130.0138 1450 gi|260072571|gb|ACX30471.1| 0.9999 2 4 KMGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 94 45.934 -130.0138 1450 gi|260072571|gb|ACX30471.1| 0.9999 2 4 MGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 94 45.934 -130.0138 1450 gi|269467995|gb|EEZ79723.1| 0.9999 2 4 KMGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 94 45.934 -130.0138 1450 gi|269467995|gb|EEZ79723.1| 0.9999 2 4 MGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 99 45.934 -130.0138 1450 gi|148244349|ref|YP_001219043.1| 0.9998 2 4 HSADYIDSVMSR Gamma sulfur oxidizers_preprotein translocase SecY subunit Genetic Information Processing; Folding; sorting and degradation; Protein export 99 45.934 -130.0138 1450 gi|148244349|ref|YP_001219043.1| 0.9998 2 4 HSADYIDSVM[147]SR Gamma sulfur oxidizers_preprotein translocase SecY subunit Genetic Information Processing; Folding; sorting and degradation; Protein export 139 45.934 -130.0138 1450 gi|148244867|ref|YP_001219561.1| 0.9949 1 4 NPPILIFDEATSALDSYSEK Gamma sulfur oxidizers_ABC transporter ATP-binding protein Unassigned 143 45.934 -130.0138 1450 gi|269467872|gb|EEZ79615.1| 0.9949 1 4 MDAVSQESNELSAK Gamma sulfur oxidizers_hypothetical protein Sup05_0945 Unassigned 145 45.934 -130.0138 1450 gi|269467939|gb|EEZ79674.1| 0.9949 1 4 ALAPVLDEIADEYDGK Gamma sulfur oxidizers_thioredoxin Unassigned 146 45.934 -130.0138 1450 gi|269468052|gb|EEZ79770.1| 0.9949 1 4 ENFVTDNGNLILDVEGLK Gamma sulfur oxidizers_ribose 5-phosphate isomerase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or carbohydrate metabolism; pentose phosphate pathway 146 45.934 -130.0138 1450 gi|269468267|gb|EEZ79951.1| 0.9949 1 4 ENFVTDNGNLILDVEGLK Gamma sulfur oxidizers_ribose 5-phosphate isomerase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or carbohydrate metabolism; pentose phosphate pathway 148 45.934 -130.0138 1450 gi|269468078|gb|EEZ79792.1| 0.9949 1 4 SANIALVLYADGER Gamma sulfur oxidizers_ribosomal protein L2 Genetic Information Processing; Translation; Ribosome 148 45.934 -130.0138 1450 gi|356960593|ref|ZP_09063575.1| 0.9949 1 4 SANIALVLYADGER Gamma sulfur oxidizers_ribosomal protein L2 Genetic Information Processing; Translation; Ribosome 151 45.934 -130.0138 1450 gi|269468628|gb|EEZ80272.1| 0.9949 1 4 SGIGIEDILEQIVEK Gamma sulfur oxidizers_membrane GTPase LepA Unassigned 156 45.934 -130.0138 1450 gi|71083646|ref|YP_266366.1| 0.9949 1 4 ADEVVAAYDSGR SAR11_yhdW gene product Environmental Information Processing; Membrane transport; ABC transporters 156 45.934 -130.0138 1450 gi|91717727|gb|EAS84378.1| 0.9949 1 4 ADEVVAAYDSGR SAR11_yhdW gene product Environmental Information Processing; Membrane transport; ABC transporters 171 45.934 -130.0138 1450 gi|291612537|ref|YP_003522694.1| 0.9693 1 4 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 171 45.934 -130.0138 1450 gi|291614116|ref|YP_003524273.1| 0.9693 1 4 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 171 45.934 -130.0138 1450 gi|302877315|ref|YP_003845879.1| 0.9693 1 4 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 171 45.934 -130.0138 1450 gi|344259861|gb|EGW20133.1| 0.9693 1 4 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 171 45.934 -130.0138 1450 gi|344259863|gb|EGW20135.1| 0.9693 1 4 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 171 45.934 -130.0138 1450 gi|357404221|ref|YP_004916145.1| 0.9693 1 4 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 171 45.934 -130.0138 1450 gi|357404223|ref|YP_004916147.1| 0.9693 1 4 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 172 45.934 -130.0138 1450 gi|118602495|ref|YP_903710.1| 0.9688 1 4 VLVVGSETLSR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism; Lipid metabolism; Fatty acid biosynthesis 172 45.934 -130.0138 1450 gi|148244595|ref|YP_001219289.1| 0.9688 1 4 VLVVGSETLSR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism; Lipid metabolism; Fatty acid biosynthesis 172 45.934 -130.0138 1450 gi|269467947|gb|EEZ79682.1| 0.9688 1 4 VLVVGSETLSR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism; Lipid metabolism; Fatty acid biosynthesis 202 45.934 -130.0138 1450 gi|269467886|gb|EEZ79625.1| 0.9291 1 4 DNVNVFYAPGAFEIPLLAK Gamma sulfur oxidizers_riboflavin synthase beta-chain Metabolism; Lipid metabolism; Fatty acid biosynthesis 206 45.934 -130.0138 1450 gi|118603031|ref|YP_904246.1| 0.9233 1 4 LGEEVDNVLR Gamma sulfur oxidizers_ribulose-5-phosphate 3-epimerase Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms 206 45.934 -130.0138 1450 gi|269469078|gb|EEZ80633.1| 0.9233 1 4 LGEEVDNVLR Gamma sulfur oxidizers_ribulose-5-phosphate 3-epimerase Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms 212 45.934 -130.0138 1450 gi|148245106|ref|YP_001219800.1| 0.9175 1 4 VLVINSLDDLK Gamma sulfur oxidizers_hypothetical protein COSY_0978 Unassigned 214 45.934 -130.0138 1450 gi|148244674|ref|YP_001219368.1| 0.9166 1 4 VAILDADIYGPSQPR Gamma sulfur oxidizers_Mrp-ATPase Unassigned 104a 45.934 -130.0138 1450 gi|269467769|gb|EEZ79530.1| 0.9998 2 4 IAIIGSGPAGLAAADELNK Gamma sulfur oxidizers_NADPH-dependent glutamate synthase beta chain Metabolism; Energy Metabolism; Oxidative phosphorylation 104a 45.934 -130.0138 1450 gi|269467769|gb|EEZ79530.1| 0.9998 2 4 ADNNPWPLWPLIYR Gamma sulfur oxidizers_NADPH-dependent glutamate synthase beta chain Metabolism; Energy Metabolism; Oxidative phosphorylation 110a 45.934 -130.0138 1450 gi|148244930|ref|YP_001219624.1| 0.9992 2 4 IGWPAFFEK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrB Metabolism; Xenobiotics Biodegradation and Metabolism; Nitrotoluene degradation 110a 45.934 -130.0138 1450 gi|148244930|ref|YP_001219624.1| 0.9992 2 4 NHEEIWTVR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrB Metabolism; Xenobiotics Biodegradation and Metabolism; Nitrotoluene degradation 115a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 0.9991 2 4 SALEIVETAK Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing; Translation; Ribosome 115a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 0.9991 2 4 FTVLTSPHVNKK Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing; Translation; Ribosome 118a 45.934 -130.0138 1450 gi|269468121|gb|EEZ79831.1| 0.9981 2 4 IISLGEGNTPLIR Gamma sulfur oxidizers_L-threonine synthase Metabolism; Amino Acid Metabolism; Glycine; serine and threonine metabolism or Metabolism of Cofactors and Vitamins; Vitamin B6 metabolism 118a 45.934 -130.0138 1450 gi|269468121|gb|EEZ79831.1| 0.9981 2 4 EVADHAPVSIVNSINPYR Gamma sulfur oxidizers_L-threonine synthase Metabolism; Amino Acid Metabolism; Glycine; serine and threonine metabolism or Metabolism of Cofactors and Vitamins; Vitamin B6 metabolism 123a 45.934 -130.0138 1450 gi|344259865|gb|EGW20137.1| 0.9852 2 4 ADEVLELK Methylotrophs_glutamine synthetase; type I Metabolism; Carbohydrate Metabolism; Glyoxylate and dicarboxylate metabolism or Energy Metabolism; Nitrogen metabolism or Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism or Arginine and proline metabolism 123a 45.934 -130.0138 1450 gi|344259865|gb|EGW20137.1| 0.9852 2 4 MFDGSSVAGWK Methylotrophs_glutamine synthetase; type I Metabolism; Carbohydrate Metabolism; Glyoxylate and dicarboxylate metabolism or Energy Metabolism; Nitrogen metabolism or Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism or Arginine and proline metabolism 176a 45.934 -130.0138 1450 gi|291613478|ref|YP_003523635.1| 0.9578 1 4 DVVILLDSITR Methylotrophs_transcription termination factor Rho Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 176a 45.934 -130.0138 1450 gi|302879646|ref|YP_003848210.1| 0.9578 1 4 DVVILLDSITR Methylotrophs_transcription termination factor Rho Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 176a 45.934 -130.0138 1450 gi|71083054|ref|YP_265773.1| 0.9578 1 4 DVVILLDSITR Methylotrophs_transcription termination factor Rho Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 176a 45.934 -130.0138 1450 gi|91718323|gb|EAS84973.1| 0.9578 1 4 DVVILLDSITR Methylotrophs_transcription termination factor Rho Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 215a 45.934 -130.0138 1450 gi|118602277|ref|YP_903492.1| 0.9105 1 4 SVTDIWASADWYER Gamma sulfur oxidizers_NADH dehydrogenase I chain C Metabolism; Energy Metabolism; Oxidative phosphorylation 215a 45.934 -130.0138 1450 gi|148244391|ref|YP_001219085.1| 0.9105 1 4 SVTDIWASADWYER Gamma sulfur oxidizers_NADH dehydrogenase I chain C Metabolism; Energy Metabolism; Oxidative phosphorylation 105 45.934 -130.0138 1450 gi|118602270|ref|YP_903485.1| 0.9997 1 3 VTDSETMDVVEMVLGGLVNK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism; Amino Acid Metabolism; Arginine and proline metabolism 105 45.934 -130.0138 1450 gi|148244383|ref|YP_001219077.1| 0.9997 1 3 VTDSETMDVVEMVLGGLVNK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism; Amino Acid Metabolism; Arginine and proline metabolism 105 45.934 -130.0138 1450 gi|269468042|gb|EEZ79760.1| 0.9997 1 3 VTDSETMDVVEMVLGGLVNK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism; Amino Acid Metabolism; Arginine and proline metabolism 105 45.934 -130.0138 1450 gi|357403518|ref|YP_004915442.1| 0.9997 1 3 VTDSETMDVVEMVLGGLVNK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism; Amino Acid Metabolism; Arginine and proline metabolism 130 45.934 -130.0138 1450 gi|118602338|ref|YP_903553.1| 0.9949 1 3 AYDNPAFVEDLVR Gamma sulfur oxidizers_hypothetical protein Sup05_0756 Unassigned 130 45.934 -130.0138 1450 gi|148244445|ref|YP_001219139.1| 0.9949 1 3 AYDNPAFVEDLVR Gamma sulfur oxidizers_hypothetical protein Sup05_0756 Unassigned 130 45.934 -130.0138 1450 gi|269467765|gb|EEZ79529.1| 0.9949 1 3 AYDNPAFVEDLVR Gamma sulfur oxidizers_hypothetical protein Sup05_0756 Unassigned 132 45.934 -130.0138 1450 gi|118602837|ref|YP_904052.1| 0.9949 1 3 DYFEEYQIAPAVR Gamma sulfur oxidizers_DsrC family protein Genetic Information Processing; Folding; sorting and degradation; Sulfur relay system 132 45.934 -130.0138 1450 gi|269467776|gb|EEZ79537.1| 0.9949 1 3 DYFEEYQIAPAVR Gamma sulfur oxidizers_DsrC family protein Genetic Information Processing; Folding; sorting and degradation; Sulfur relay system 134 45.934 -130.0138 1450 gi|118602885|ref|YP_904100.1| 0.9949 1 3 IISIASVVGAMGNAGQTNYAAAK Gamma sulfur oxidizers_3-oxoacyl-[acyl-carrier-protein] reductase Metabolism; Lipid metabolism; Fatty acid biosynthesis 134 45.934 -130.0138 1450 gi|148244958|ref|YP_001219652.1| 0.9949 1 3 IISIASVVGAMGNAGQTNYAAAK Gamma sulfur oxidizers_3-oxoacyl-[acyl-carrier-protein] reductase Metabolism; Lipid metabolism; Fatty acid biosynthesis 134 45.934 -130.0138 1450 gi|269468377|gb|EEZ80042.1| 0.9949 1 3 IISIASVVGAMGNAGQTNYAAAK Gamma sulfur oxidizers_3-oxoacyl-[acyl-carrier-protein] reductase Metabolism; Lipid metabolism; Fatty acid biosynthesis 141 45.934 -130.0138 1450 gi|260072676|gb|ACX30573.1| 0.9949 1 3 TQVVVIGSGPGGYTAAFR Gamma sulfur oxidizers_pyruvate dehydrogenase complex E3 component Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) 150 45.934 -130.0138 1450 gi|269468401|gb|EEZ80066.1| 0.9949 1 3 ETSSMIINQPLDTVEMR Gamma sulfur oxidizers_ribosomal protein S9 Genetic Information Processing; Translation; Ribosome 161 45.934 -130.0138 1450 gi|118602599|ref|YP_903814.1| 0.9837 3 3 SEGFISLDEFK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 161 45.934 -130.0138 1450 gi|118602599|ref|YP_903814.1| 0.9837 3 3 QLTASPWDNISDR Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 161 45.934 -130.0138 1450 gi|118602599|ref|YP_903814.1| 0.9837 3 3 GGLTVDIGVVK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing; Translation; Ribosome 164 45.934 -130.0138 1450 gi|269468979|gb|EEZ80555.1| 0.9746 1 3 SVGLNAIILSVLYK Gamma sulfur oxidizers_DNA segregation ATPase FtsK/SpoIIIE Unassigned 165 45.934 -130.0138 1450 gi|118602677|ref|YP_903892.1| 0.9741 1 3 GYGFITGDDGEK Gamma sulfur oxidizers_cold-shock DNA-binding domain-containing protein Unassigned 165 45.934 -130.0138 1450 gi|260072563|gb|ACX30463.1| 0.9741 1 3 GYGFITGDDGEK Gamma sulfur oxidizers_cold-shock DNA-binding domain-containing protein Unassigned 165 45.934 -130.0138 1450 gi|269468003|gb|EEZ79731.1| 0.9741 1 3 GYGFITGDDGEK Gamma sulfur oxidizers_cold-shock DNA-binding domain-containing protein Unassigned 169 45.934 -130.0138 1450 gi|357406659|ref|YP_004918583.1| 0.9707 1 3 AIAAGITEVAFDR Methylotrophs_rplR gene product Genetic Information Processing; Translation; Ribosome 170 45.934 -130.0138 1450 gi|269468175|gb|EEZ79874.1| 0.9703 1 3 INFSHGSEEEHLGR Gamma sulfur oxidizers_pyruvate kinase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism; Glycolysis / Gluconeogenesis; or pyruvate metabolism or Nucleotide Metabolism; Purine metabolism 174 45.934 -130.0138 1450 gi|269468480|gb|EEZ80141.1| 0.9659 1 3 AGNTLFYQLNGPMSFGSAK Gamma sulfur oxidizers_sulfate permease family protein Unassigned 178 45.934 -130.0138 1450 gi|356960153|ref|ZP_09063135.1| 0.9602 1 3 AVNDNTSAAGIGITGK Gamma sulfur oxidizers_extracellular solute-binding protein Unassigned 179 45.934 -130.0138 1450 gi|118602287|ref|YP_903502.1| 0.9597 1 3 EISTYGGVINSMPK Gamma sulfur oxidizers_proton-translocating NADH-quinone oxidoreductase; chain M Metabolism; Energy metabolism; Oxidative phosphorylation 179 45.934 -130.0138 1450 gi|269468287|gb|EEZ79969.1| 0.9597 1 3 EISTYGGVINSMPK Gamma sulfur oxidizers_proton-translocating NADH-quinone oxidoreductase; chain M Metabolism; Energy metabolism; Oxidative phosphorylation 180 45.934 -130.0138 1450 gi|269468174|gb|EEZ79873.1| 0.9592 1 3 NEVVEDGDLVVLTK Gamma sulfur oxidizers_pyruvate kinase Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism; Glycolysis / Gluconeogenesis; or pyruvate metabolism or Nucleotide Metabolism; Purine metabolism 189 45.934 -130.0138 1450 gi|269468013|gb|EEZ79738.1| 0.9479 1 3 MDFTQSELDTIQK Gamma sulfur oxidizers_hypothetical protein Sup05_0126 Unassigned 195 45.934 -130.0138 1450 gi|71082868|ref|YP_265587.1| 0.9378 1 3 VGNEGVITVEEAK SAR11_groEL gene product Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 195 45.934 -130.0138 1450 gi|91718511|gb|EAS85161.1| 0.9378 1 3 VGNEGVITVEEAK SAR11_groEL gene product Genetic Information Processing; Folding; Sorting and Degradation; RNA degradation 213 45.934 -130.0138 1450 gi|269468151|gb|EEZ79855.1| 0.9171 1 3 GIDTVLAEIR Gamma sulfur oxidizers_ribosomal protein L28 Genetic Information Processing; Translation; Ribosome 213 45.934 -130.0138 1450 gi|269468485|gb|EEZ80146.1| 0.9171 1 3 GIDTVLAEIR Gamma sulfur oxidizers_ribosomal protein L28 Genetic Information Processing; Translation; Ribosome 219 45.934 -130.0138 1450 gi|344259828|gb|EGW20100.1| 0.91 1 3 VDGDDLIVMR Methylotrophs_10 kDa chaperonin Unassigned 102a 45.934 -130.0138 1450 gi|118602654|ref|YP_903869.1| 0.9998 2 3 ALIVGVASNR Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism; Lipid Metabolism; Fatty acid biosynthesis 102a 45.934 -130.0138 1450 gi|118602654|ref|YP_903869.1| 0.9998 2 3 LLDYAADSSALKR Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism; Lipid Metabolism; Fatty acid biosynthesis 102a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 0.9998 2 3 ALIVGVASNR Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism; Lipid Metabolism; Fatty acid biosynthesis 102a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 0.9998 2 3 LLDYAADSSALKR Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism; Lipid Metabolism; Fatty acid biosynthesis 109a 45.934 -130.0138 1450 gi|118602821|ref|YP_904036.1| 0.9996 2 3 ILLSQVPGGMLTNMESQLR Gamma sulfur oxidizers_oxaloacetate decarboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or Amino Acid Metabolism; Arginine and proline metabolism 109a 45.934 -130.0138 1450 gi|118602821|ref|YP_904036.1| 0.9996 2 3 DMAGLLQPYVAYDLVK Gamma sulfur oxidizers_oxaloacetate decarboxylase Metabolism; Carbohydrate Metabolism; Pyruvate metabolism or Amino Acid Metabolism; Arginine and proline metabolism 113a 45.934 -130.0138 1450 gi|344262284|gb|EGW22555.1| 0.9993 2 3 TIAVLTHDSIGQGEDGPTHQPIENTSAMR Methylotrophs_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 113a 45.934 -130.0138 1450 gi|344262284|gb|EGW22555.1| 0.9993 2 3 VVSMPSTNVFDR Methylotrophs_transketolase Metabolism; Carbohydrate Metabolism; Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides; Biosynthesis of ansamycins 114a 45.934 -130.0138 1450 gi|269468934|gb|EEZ80518.1| 0.999 2 3 GPVGLEGLTSQK Gamma sulfur oxidizers_gamma-glutamyl phosphate reductase Metabolism; Amino Acid Metabolism; Arginine and proline metabolism 114a 45.934 -130.0138 1450 gi|269468934|gb|EEZ80518.1| 0.999 2 3 VLPELIAEYIAK Gamma sulfur oxidizers_gamma-glutamyl phosphate reductase Metabolism; Amino Acid Metabolism; Arginine and proline metabolism 122a 45.934 -130.0138 1450 gi|118602063|ref|YP_903278.1| 0.9872 2 3 YLPELIENGYLYIAQPPLYK Gamma sulfur oxidizers_DNA gyrase subunit B Unassigned 122a 45.934 -130.0138 1450 gi|118602063|ref|YP_903278.1| 0.9872 2 3 TQAILPLK Gamma sulfur oxidizers_DNA gyrase subunit B Unassigned 52a 45.934 -130.0138 1450 gi|148244696|ref|YP_001219390.1| 1 2 3 LVMLFTDSPSIR Gamma sulfur oxidizers_lysyl-tRNA synthetase; class II Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 52a 45.934 -130.0138 1450 gi|148244696|ref|YP_001219390.1| 1 2 3 ALEYGMPPTAGEGIGIDR Gamma sulfur oxidizers_lysyl-tRNA synthetase; class II Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 52a 45.934 -130.0138 1450 gi|269469084|gb|EEZ80637.1| 1 2 3 LVMLFTDSPSIR Gamma sulfur oxidizers_lysyl-tRNA synthetase; class II Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 52a 45.934 -130.0138 1450 gi|269469084|gb|EEZ80637.1| 1 2 3 ALEYGMPPTAGEGIGIDR Gamma sulfur oxidizers_lysyl-tRNA synthetase; class II Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 52a 45.934 -130.0138 1450 gi|269469091|gb|EEZ80642.1| 1 2 3 LVMLFTDSPSIR Gamma sulfur oxidizers_lysyl-tRNA synthetase; class II Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 52a 45.934 -130.0138 1450 gi|269469091|gb|EEZ80642.1| 1 2 3 ALEYGMPPTAGEGIGIDR Gamma sulfur oxidizers_lysyl-tRNA synthetase; class II Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 57b 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9854 6 3 DLDAMVYEIDEAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57b 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9854 6 3 DLDAM[147]VYEIDEAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57b 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9854 6 3 LPGFFENLGHGNVINTSGGGSYGHIDSPAAGAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57b 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9854 6 3 GYTAFVLGK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57b 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9854 6 3 DSADGPVYHQEWFGMKPTTPIISGGMNALR Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 57b 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9854 6 3 NIAYMIER Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism; Energy Metabolism; Carbon fixation in photosynthetic organisms 74a 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 4 3 GLQFLDLIQEGNVGLMK Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74a 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 4 3 EPLSMETPVGDDEDSNIGDFIEDTNLSSPVEITTR Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74a 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 4 3 IPVHMIETINK Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 74a 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 4 3 EATPEELAVEMELPEYK Gamma sulfur oxidizers_DNA-directed RNA polymerase; sigma subunit Genetic Information Processing; Transcription; RNA polymerase 88b 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9709 4 3 DRGEDALIVYDDLTK Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88b 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9709 4 3 EAYPGDVFYLHSR Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88b 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9709 4 3 GEDALIVYDDLTK Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 88b 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9709 4 3 AIDAMVPVGR Iron oxidizers_ATP synthase F1; subunit alpha Metabolism; Energy Metabolism; Oxidative phosphorylation 108 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 0.9996 2 2 WGTTIDNLLSWK Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 108 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 0.9996 2 2 MLFEVLGDMWAVNR Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 116 45.934 -130.0138 1450 gi|291613825|ref|YP_003523982.1| 0.9987 1 2 FHWAVADYLQR Iron oxidizers_phosphofructokinase Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis 121 45.934 -130.0138 1450 gi|269467932|gb|EEZ79667.1| 0.9976 2 2 DFPEFYPWYSEK Gamma sulfur oxidizers_D-alanyl-D-alanine carboxypeptidase Metabolism; Glycan Biosynthesis and Metabolism; Peptidoglycan biosynthesis 121 45.934 -130.0138 1450 gi|269467932|gb|EEZ79667.1| 0.9976 2 2 FENASGLDYK Gamma sulfur oxidizers_D-alanyl-D-alanine carboxypeptidase Metabolism; Glycan Biosynthesis and Metabolism; Peptidoglycan biosynthesis 133 45.934 -130.0138 1450 gi|118602853|ref|YP_904068.1| 0.9949 1 2 HNDLENVGYTAR Gamma sulfur oxidizers_alanyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 133 45.934 -130.0138 1450 gi|148244942|ref|YP_001219636.1| 0.9949 1 2 HNDLENVGYTAR Gamma sulfur oxidizers_alanyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 133 45.934 -130.0138 1450 gi|291614561|ref|YP_003524718.1| 0.9949 1 2 HNDLENVGYTAR Gamma sulfur oxidizers_alanyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 133 45.934 -130.0138 1450 gi|302877754|ref|YP_003846318.1| 0.9949 1 2 HNDLENVGYTAR Gamma sulfur oxidizers_alanyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 133 45.934 -130.0138 1450 gi|344260660|gb|EGW20932.1| 0.9949 1 2 HNDLENVGYTAR Gamma sulfur oxidizers_alanyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 133 45.934 -130.0138 1450 gi|357406172|ref|YP_004918096.1| 0.9949 1 2 HNDLENVGYTAR Gamma sulfur oxidizers_alanyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 144 45.934 -130.0138 1450 gi|269467938|gb|EEZ79673.1| 0.9949 1 2 LNDILLQLLEDR Gamma sulfur oxidizers_UTP:GlnB uridylyltransferase Environmental Information Processing; Signal transduction; Two-component system 152 45.934 -130.0138 1450 gi|269468770|gb|EEZ80379.1| 0.9949 1 2 DTTLIDNTPIDYLDFASPVSGLGSK Gamma sulfur oxidizers_3-polyprenyl-4-hydroxybenzoate decarboxylase Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis 155 45.934 -130.0138 1450 gi|357406527|ref|YP_004918451.1| 0.9949 1 2 AEAPLSEMFGYIGDLR Methylotrophs_fusA gene product Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis 158 45.934 -130.0138 1450 gi|118602835|ref|YP_904050.1| 0.9908 3 2 YPQPQHIIEYTHDLIQR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 158 45.934 -130.0138 1450 gi|118602835|ref|YP_904050.1| 0.9908 3 2 EFDIPVLPTYLEIPELK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 158 45.934 -130.0138 1450 gi|118602835|ref|YP_904050.1| 0.9908 3 2 AALDLEVSR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 160 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9861 3 2 YPQPQHIIEYTHDLIQR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 160 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9861 3 2 ESTFCCGGGGGLLTDDLMEIR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 160 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9861 3 2 AALDLEVSR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 162 45.934 -130.0138 1450 gi|357404814|ref|YP_004916738.1| 0.9785 1 2 YTNILMGTVQAAIANGVLDAVR Methylotrophs_fae gene product Unassigned 163 45.934 -130.0138 1450 gi|118602768|ref|YP_903983.1| 0.9746 1 2 ALADFLFDTEQAIVR Gamma sulfur oxidizers_ATPase Unassigned 163 45.934 -130.0138 1450 gi|148244858|ref|YP_001219552.1| 0.9746 1 2 ALADFLFDTEQAIVR Gamma sulfur oxidizers_ATPase Unassigned 163 45.934 -130.0138 1450 gi|269468202|gb|EEZ79895.1| 0.9746 1 2 ALADFLFDTEQAIVR Gamma sulfur oxidizers_ATPase Unassigned 173 45.934 -130.0138 1450 gi|118602222|ref|YP_903437.1| 0.9683 1 2 HWALLEVVEK Gamma sulfur oxidizers_30S ribosomal protein S17 Genetic Information Processing; Translation; Ribosome 173 45.934 -130.0138 1450 gi|269468083|gb|EEZ79797.1| 0.9683 1 2 HWALLEVVEK Gamma sulfur oxidizers_30S ribosomal protein S17 Genetic Information Processing; Translation; Ribosome 175 45.934 -130.0138 1450 gi|269467816|gb|EEZ79568.1| 0.965 1 2 SQGAFYSFPR Gamma sulfur oxidizers_Aspartate/tyrosine/aromatic aminotransferase Metabolism; Amino acid metabolism; 181 45.934 -130.0138 1450 gi|269468556|gb|EEZ80205.1| 0.9592 1 2 AGIIGGTGYTGVELLR Gamma sulfur oxidizers_acetylglutamate semialdehyde dehydrogenase Metabolism; Amino acid metabolism; Arginine and proline metabolism 182 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 0.9566 3 2 YPQPQHIIEYTHDLIQR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 182 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 0.9566 3 2 AALDLEVSR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 182 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 0.9566 3 2 SVEEFQTPLGFPGEK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 184 45.934 -130.0138 1450 gi|344262174|gb|EGW22445.1| 0.9554 1 2 LGFFNPLAR Methylotrophs_30S ribosomal protein S16 Genetic Information Processing; Translation; Ribosome 187 45.934 -130.0138 1450 gi|269467837|gb|EEZ79583.1| 0.9517 1 2 LIFALDVPEVDQAK Gamma sulfur oxidizers_orotidine-5P-phosphate decarboxylase Metabolism; Nucleotide Metabolism; Pyrimidine metabolism 188 45.934 -130.0138 1450 gi|269469002|gb|EEZ80570.1| 0.9517 1 2 NNIPTAYYDVFTEVAPAVK Gamma sulfur oxidizers_phosphoribosylamine-glycine ligase Metabolism; Nucleotide metabolism; Purine metabolism 196 45.934 -130.0138 1450 gi|269468607|gb|EEZ80251.1| 0.935 1 2 VTGFLEGEDALSTLK Gamma sulfur oxidizers_5-enolpyruvylshikimate-3-phosphate synthase Metabolism; Amino acid metabolism; Phenylalanine; tyrosine and tryptophan biosynthesis 201 45.934 -130.0138 1450 gi|118602262|ref|YP_903477.1| 0.93 1 2 FTDASYAYQGGGR Gamma sulfur oxidizers_thymidylate kinase Metabolism; Nucleotide metabolism; Pyrimidine metabolism 201 45.934 -130.0138 1450 gi|148244374|ref|YP_001219068.1| 0.93 1 2 FTDASYAYQGGGR Gamma sulfur oxidizers_thymidylate kinase Metabolism; Nucleotide metabolism; Pyrimidine metabolism 201 45.934 -130.0138 1450 gi|269468275|gb|EEZ79959.1| 0.93 1 2 FTDASYAYQGGGR Gamma sulfur oxidizers_thymidylate kinase Metabolism; Nucleotide metabolism; Pyrimidine metabolism 209 45.934 -130.0138 1450 gi|148244986|ref|YP_001219680.1| 0.9219 1 2 IFEDENILVNPTAVR Gamma sulfur oxidizers_aspartate-semialdehyde dehydrogenase Metabolism; Amino acid metabolism 211 45.934 -130.0138 1450 gi|118602276|ref|YP_903491.1| 0.9184 1 2 VYDQMPEPR SAR11_nuoB gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 211 45.934 -130.0138 1450 gi|269469169|gb|EEZ80711.1| 0.9184 1 2 VYDQMPEPR SAR11_nuoB gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 211 45.934 -130.0138 1450 gi|71083583|ref|YP_266302.1| 0.9184 1 2 VYDQMPEPR SAR11_nuoB gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 211 45.934 -130.0138 1450 gi|91717798|gb|EAS84448.1| 0.9184 1 2 VYDQMPEPR SAR11_nuoB gene product Metabolism; Energy Metabolism; Oxidative phosphorylation 216 45.934 -130.0138 1450 gi|269469222|gb|EEZ80753.1| 0.9148 1 2 MVGGQSSYLPLK Gamma sulfur oxidizers_preprotein translocase subunit SecY Genetic Information Processing; Folding; Sorting and Degradation; Protein export 216 45.934 -130.0138 1450 gi|356960610|ref|ZP_09063592.1| 0.9148 1 2 MVGGQSSYLPLK Gamma sulfur oxidizers_preprotein translocase subunit SecY Genetic Information Processing; Folding; Sorting and Degradation; Protein export 217 45.934 -130.0138 1450 gi|269468929|gb|EEZ80513.1| 0.9118 1 2 TTSGDGIVSALQVLEVLAK Gamma sulfur oxidizers_phosphomannomutase Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism 218 45.934 -130.0138 1450 gi|269467937|gb|EEZ79672.1| 0.9109 1 2 DAGFLPEALLNYLVR Gamma sulfur oxidizers_Glutamyl- and glutaminyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 221 45.934 -130.0138 1450 gi|269467840|gb|EEZ79586.1| 0.9039 1 2 VFDGDSPSLLNFK Gamma sulfur oxidizers_2-polyprenyl-6-methoxyphenol hydroxylase Unassigned 107a 45.934 -130.0138 1450 gi|148244531|ref|YP_001219225.1| 0.9997 2 2 WGADTIMDLSTGK Gamma sulfur oxidizers_thiamine biosynthesis protein ThiC Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism 107a 45.934 -130.0138 1450 gi|148244531|ref|YP_001219225.1| 0.9997 2 2 NSPVPIGTVPIYQALEK Gamma sulfur oxidizers_thiamine biosynthesis protein ThiC Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism 111a 45.934 -130.0138 1450 gi|269468354|gb|EEZ80025.1| 0.9992 2 2 GTTSEQIVQMAR Gamma sulfur oxidizers_glutamine phosphoribosylpyrophosphate amidotransferase Metabolism; Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism or nucleotide metabolism; purine metabolism 111a 45.934 -130.0138 1450 gi|269468354|gb|EEZ80025.1| 0.9992 2 2 DIEPGEAVVIDR Gamma sulfur oxidizers_glutamine phosphoribosylpyrophosphate amidotransferase Metabolism; Amino Acid Metabolism; Alanine; aspartate and glutamate metabolism or nucleotide metabolism; purine metabolism 117a 45.934 -130.0138 1450 gi|148244560|ref|YP_001219254.1| 0.9982 2 2 LAESYGHIGIK Gamma sulfur oxidizers_acetolactate synthase large subunit Metabolism; Amino Acid; Carbohydrate; or Vitamins and Cofactors 117a 45.934 -130.0138 1450 gi|148244560|ref|YP_001219254.1| 0.9982 2 2 WINSGGLGTMGFGLPAAMGAK Gamma sulfur oxidizers_acetolactate synthase large subunit Metabolism; Amino Acid; Carbohydrate; or Vitamins and Cofactors 119a 45.934 -130.0138 1450 gi|118602474|ref|YP_903689.1| 0.9978 2 2 GINALQMDIK Gamma sulfur oxidizers_polynucleotide phosphorylase/polyadenylase Metabolism; Nucleotide metabolism; 119a 45.934 -130.0138 1450 gi|118602474|ref|YP_903689.1| 0.9978 2 2 GETQALVVTTLGSK Gamma sulfur oxidizers_polynucleotide phosphorylase/polyadenylase Metabolism; Nucleotide metabolism; 120a 45.934 -130.0138 1450 gi|269468016|gb|EEZ79741.1| 0.9977 2 2 MNVILLGPPGAGK Gamma sulfur oxidizers_adenylate kinase Metabolism; Nucleotide Metabolism; Purine metabolism 120a 45.934 -130.0138 1450 gi|269468016|gb|EEZ79741.1| 0.9977 2 2 VM[147]DAGGLVSDDIIIGLVK Gamma sulfur oxidizers_adenylate kinase Metabolism; Nucleotide Metabolism; Purine metabolism 142 45.934 -130.0138 1450 gi|269467858|gb|EEZ79601.1| 0.9949 1 1 NMSVKEQANEVR Gamma sulfur oxidizers_IMP dehydrogenase/GMP reductase Metabolism; Nucleotide metabolism; Purine metabolism 154 45.934 -130.0138 1450 gi|291613253|ref|YP_003523410.1| 0.9949 1 1 VYMQPASEGTGIIAGGAMR Bacteria_30S ribosomal protein S5 Genetic Information Processing; Translation; Ribosome 154 45.934 -130.0138 1450 gi|344262230|gb|EGW22501.1| 0.9949 1 1 VYMQPASEGTGIIAGGAMR Bacteria_30S ribosomal protein S5 Genetic Information Processing; Translation; Ribosome 168 45.934 -130.0138 1450 gi|269468339|gb|EEZ80013.1| 0.9716 2 1 GWTLYQIVEQYMR Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 168 45.934 -130.0138 1450 gi|269468339|gb|EEZ80013.1| 0.9716 2 1 SFDQPLNVFEVAK Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 185 45.934 -130.0138 1450 gi|269468566|gb|EEZ80215.1| 0.9545 1 1 GAGGFAGELLFHPFGK Gamma sulfur oxidizers_F0F1-type ATP synthase; subunit a Metabolism; Energy metabolism; Oxidative phosphorylation 190 45.934 -130.0138 1450 gi|269468541|gb|EEZ80195.1| 0.9479 1 1 YNFEIADTEVLFR Gamma sulfur oxidizers_glycyl-tRNA synthetase; alpha subunit Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis 191 45.934 -130.0138 1450 gi|148244667|ref|YP_001219361.1| 0.9433 1 1 LSDCISTDLNQTEVFLVEGDSAGGSAK Gamma sulfur oxidizers_DNA topoisomerase IV subunit B Unassigned 192 45.934 -130.0138 1450 gi|269469235|gb|EEZ80763.1| 0.9433 1 1 IATFEDDEGAYDQK Gamma sulfur oxidizers_argininosuccinate synthase Metabolism; Amino acid metabolism 193 45.934 -130.0138 1450 gi|269468117|gb|EEZ79827.1| 0.9405 1 1 LVLGLGDTGLSIAR Gamma sulfur oxidizers_UDP-N-acetylmuramoylalanine-D-glutamate ligase Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis 198 45.934 -130.0138 1450 gi|357404260|ref|YP_004916184.1| 0.935 1 1 FRPGTEEGDYQVK Methylotrophs_translation initiation factor Unassigned 199 45.934 -130.0138 1450 gi|269467764|gb|EEZ79528.1| 0.9346 1 1 GLINDPDLDESFNIDK Gamma sulfur oxidizers_3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase Metabolism; Amino acid metabolism; Phenylalanine; tyrosine and tryptophan biosynthesis 200 45.934 -130.0138 1450 gi|118602820|ref|YP_904035.1| 0.9337 1 1 INPLIGSAGVSAVPMAAR Gamma sulfur oxidizers_sodium ion-translocating decarboxylase; beta subunit Metabolism; Carbohydrate metabolism; Pyruvate metabolism 200 45.934 -130.0138 1450 gi|148244909|ref|YP_001219603.1| 0.9337 1 1 INPLIGSAGVSAVPMAAR Gamma sulfur oxidizers_sodium ion-translocating decarboxylase; beta subunit Metabolism; Carbohydrate metabolism; Pyruvate metabolism 203 45.934 -130.0138 1450 gi|118602918|ref|YP_904133.1| 0.9278 1 1 LIFIAYPNNPTGNAFDR Gamma sulfur oxidizers_histidinol-phosphate aminotransferase Metabolism; Amino acid metabolism 204 45.934 -130.0138 1450 gi|269469037|gb|EEZ80601.1| 0.9251 1 1 ITPVAELEPTLLSGATIVR Gamma sulfur oxidizers_NAD-dependent DNA ligase Genetic Information Processing; Replication and repair; DNA replication 207 45.934 -130.0138 1450 gi|269469133|gb|EEZ80678.1| 0.9228 1 1 TTDAQIGGFLVGLSMK Gamma sulfur oxidizers_anthranilate phosphoribosyltransferase Metabolism; Amino Acid Metabolism; Phenylalanine; tyrosine and tryptophan biosynthesis 210 45.934 -130.0138 1450 gi|269467887|gb|EEZ79626.1| 0.9215 1 1 WGTIEDLISYR Gamma sulfur oxidizers_3;4-dihydroxy-2-butanone 4-phosphate synthase Metabolism; Metabolism of Cofactors and Vitamins; Riboflavin metabolism 220 45.934 -130.0138 1450 gi|269468572|gb|EEZ80221.1| 0.9087 1 1 HVALLSTLKPGEVR Gamma sulfur oxidizers_F0F1-type ATP synthase; epsilon subunit Metabolism; Energy metabolism; Oxidative phosphorylation 167a 45.934 -130.0138 1450 gi|357406679|ref|YP_004918603.1| 0.9633 1 1 IVYGALDVIESK Methylotrophs_30S ribosomal protein S7 Genetic Information Processing; Translation; Ribosome 205a 45.934 -130.0138 1450 gi|269468108|gb|EEZ79818.1| 0.9179 1 1 LDPTYIIGGILNSSGINAK Gamma sulfur oxidizers_UDP-N-acetylmuramate-alanine ligase Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis 40b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9235 3 1 NILIDGQGNFGSVDGDSAAAMR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 40b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9235 3 1 YHPHGDTAVYDTIVR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 40b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9235 3 1 GKPIINLLPLEK Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 60b 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9627 3 1 VAGAVGFNVR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 60b 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9627 3 1 WQIMIHGESYKPIVAEAAK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 60b 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9627 3 1 FLTSESVFHHTLFRK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism; Energy Metabolism; Sulfur metabolism 73b 45.934 -130.0138 1450 gi|118602464|ref|YP_903679.1| 0.938 2 1 AGNTSLEELVMAVR Gamma sulfur oxidizers_2-isopropylmalate synthase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 73b 45.934 -130.0138 1450 gi|118602464|ref|YP_903679.1| 0.938 2 1 YTNDVEFSPEDAGR Gamma sulfur oxidizers_2-isopropylmalate synthase Metabolism; Amino Acid Metabolism; Valine; leucine and isoleucine biosynthesis 77b 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 0.9661 5 1 GNFMGTWDQVLVNSLR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77b 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 0.9661 5 1 LMWDVAADYLR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77b 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 0.9661 5 1 IAVIGQAFPR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77b 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 0.9661 5 1 EILEGIADNLFVQDPYLQSGGDMVR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 77b 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 0.9661 5 1 TYDAILTEK Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 93b 45.934 -130.0138 1450 gi|302877787|ref|YP_003846351.1| 0.9346 2 1 LLDQGQAGDNVGVLLR Iron oxidizers_tufB gene product Unassigned 93b 45.934 -130.0138 1450 gi|302877787|ref|YP_003846351.1| 0.9346 2 1 QVGVPYIVVFLNK Iron oxidizers_tufB gene product Unassigned 93b 45.934 -130.0138 1450 gi|302877799|ref|YP_003846363.1| 0.9346 2 1 LLDQGQAGDNVGVLLR Iron oxidizers_tufB gene product Unassigned 93b 45.934 -130.0138 1450 gi|302877799|ref|YP_003846363.1| 0.9346 2 1 QVGVPYIVVFLNK Iron oxidizers_tufB gene product Unassigned